Web/SEo/App spam
Posted by Dave Yadallee on
X-Mozilla-Status: 0001
X-Mozilla-Status2: 00000000
Return-path:
Envelope-to: dave@doctor.nl2k.ab.ca
Delivery-date: Fri, 17 Apr 2026 10:54:00 -0600
Received: from doctor by doctor.nl2k.ab.ca with local (Exim 4.98.2 (FreeBSD))
(envelope-from)
id 1wDmS3-000000007wP-0oC6
for dave@doctor.nl2k.ab.ca;
Fri, 17 Apr 2026 10:53:55 -0600
Resent-From: The Doctor
Resent-Date: Fri, 17 Apr 2026 10:53:55 -0600
Resent-Message-ID:
Resent-To: Dave Yadallee
Received: from f5mail-147-121.rediffmail.com ([119.252.147.121]:45683)
by doctor.nl2k.ab.ca with esmtp (Exim 4.98.2 (FreeBSD))
(envelope-from)
id 1wDl6X-0000000043m-0e5t
for sales@nk.ca;
Fri, 17 Apr 2026 09:27:45 -0600
Received: from f5mail-224-106.rediffmail.com (unknown [10.50.252.5])
by f5mail-147-121.rediffmail.com (Postfix) with ESMTP id 570CF241E48
for; Fri, 17 Apr 2026 20:37:43 +0530 (IST)
X-REDIFF-Delivered-Remotely-To: sales@nk.ca
DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=rediffmail.com;
s=mail; t=1776438730;
bh=QLdR+c3iTlyCWf44z+/KD/xv3AzZDmX2LxVOsmD/iwI=;
h=MIME-Version:From:Date:Message-ID:Subject:To;
b=FC7jcL6mu4iDEuO40k2bhBHBkmedVt8/DQ8HXg7+pdfP4c8F4JQObam+NdgVQ+Se9
XYmOE6NBJqvzruLo1L0cqdjwwjw4oAYWVQ8yKbU7ZgSsCCohT9EAOAQceZTU2K262r
to4MFSN5IjQITKR8wuC0L59yNjpAJlObbB3JEnNA=
Received: (qmail 3578 invoked by uid 510); 17 Apr 2026 15:12:10 -0000
x-m-msg: 5b78c3f67c9fe5a627a324586b999f93; a6da7d6asas6dasd77; 5dad65ad5sd;
X-OUT-VDRT-SpamState: 0\LEGIT
X-OUT-VDRT-SpamScore: 50
X-OUT-VDRT-SpamCause: "gggruggvucftvghtrhhoucdtuddrgeefuddrtddtucetufdoteggodetrfdotffvucfrrhhofhhilhgvmecutffgfffkhffhnecuuegrihhlohhuthemuceftddtnecuogeurggujfhtmhhlqddqufhushhpvggtthdqfghntghlohhsvgguvfgrghdqsfculdehtddmnecujfgurhepffggvffkshfuhfgtsegrtderredttdejnecuhfhrohhmpedfofgrrhihfdcuoehsmhhithhhmhgrrhihtghsshesrhgvughifhhfmhgrihhlrdgtohhmqeenucggtffrrghtthgvrhhnpeeuuddttdefjeeggeefhfelkeduveegfeeljeffveeitdffgedtkeefgeejgfekueenucfkphepudehvddrheekrddufedvrddugeefnecuvehluhhsthgvrhfuihiivgepieenucfrrghrrghmpehmrghilhhfrhhomhepshhmihhthhhmrghrhigtshhssehrvgguihhffhhmrghilhdrtghomhdpnhgspghrtghpthhtohephedpmhhouggvpehsmhhtphhouhhtpdhrtghpthhtoheprggshhhishhhvghkrdhkuhhmrghrrdgsihhgshhtohhnvghsvghosehgmhgrihhlrdgtohhmpdhrtghpthhtoheplffqjgeslffqjgffkfetpfetvffttegggffnrdevqffopdhrtghpthhtoheprghlihhsshhonhdrlhgvmhgrihhrvgesphgrthhiohgurhhumhhmohhnugdrtghomhdprhgtphhtthhopehinhhfohesthhhrhgvvghkihhnghhsshhpihhrihhtshdrtggrpdhrtghpthhtohepohhffhhitggvrggumhhinhesghhrrghnuggvrgh
irhhsohhluhhtihhonhhsrdgtohhm"
X-Dedup-Identifier: 1776438730_3577_3576_f5-224-106
Date: 17 Apr 2026 15:12:10 -0000
MIME-Version: 1.0
To: "abhishekkumarbigston seo "
Received: from unknown 152.58.132.143 by rediffmail.com via HTTP; 17 Apr 2026
15:12:10 -0000
Message-ID: <20260417204210.1776438730.3543@f5-224-106>
Sender: smithmarycss@rediffmail.com
Sensitivity:
Subject: =?utf-8?B?R29vZ2xlIGlzc3Vlcw==?=
From: "Mary"
Content-Type: multipart/alternative;
boundary="=_5c8857592c3d0fb6dff23e26940ec4d8"
X-Spam_score: 5.7
X-Spam_score_int: 57
X-Spam_bar: +++++
X-Spam_report: Spam detection software, running on the system "doctor.nl2k.ab.ca",
has identified this incoming email as possible spam. The original
message has been attached to this so you can view it or label
similar future email. If you have any questions, see
@@CONTACT_ADDRESS@@ for details.
Content preview: Hi I noticed a couple of issues on your website. Would it
help if I sent screenshots?
Content analysis details: (5.7 points, 5.0 required)
pts rule name description
---- ---------------------- --------------------------------------------------
1.5 RCVD_IN_AHBL RBL: AHBL: sender is listed in dnsbl.ahbl.org
[119.252.147.121 listed in dnsbl.ahbl.org]
[119.252.147.121 listed in dnsbl.ahbl.org]
[119.252.147.121 listed in dnsbl.ahbl.org]
[119.252.147.121 listed in dnsbl.ahbl.org]
1.5 RCVD_IN_AHBL_SPAM RBL: AHBL: Spam Source in dnsbl.ahbl.org
[119.252.147.121 listed in dnsbl.ahbl.org]
0.5 RCVD_IN_AHBL_SMTP RBL: AHBL: Open SMTP relay in dnsbl.ahbl.org
[119.252.147.121 listed in dnsbl.ahbl.org]
0.5 RCVD_IN_AHBL_PROXY RBL: AHBL: Open Proxy server in dnsbl.ahbl.org
[119.252.147.121 listed in dnsbl.ahbl.org]
0.0 RCVD_IN_AHBL_RTB RBL: AHBL: Real-Time Blocked in dnsbl.ahbl.org
[119.252.147.121 listed in dnsbl.ahbl.org]
1.0 RCVD_IN_WSFF RBL: Received via a relay in will-spam-for-food.eu.org
[119.252.147.121 listed in will-spam-for-food.eu.org]
[119.252.147.121 listed in will-spam-for-food.eu.org]
[119.252.147.121 listed in will-spam-for-food.eu.org]
[119.252.147.121 listed in will-spam-for-food.eu.org]
[119.252.147.121 listed in will-spam-for-food.eu.org]
[119.252.147.121 listed in will-spam-for-food.eu.org]
[119.252.147.121 listed in will-spam-for-food.eu.org]
[119.252.147.121 listed in will-spam-for-food.eu.org]
-0.0 SPF_PASS SPF: sender matches SPF record
0.5 NO_RDNS Sending MTA has no reverse DNS (Postfix variant)
0.2 MR_NOT_ATTRIBUTED_IP Beta rule: an non-attributed IPv4 found in
headers
0.0 FREEMAIL_FROM Sender email is commonly abused enduser mail provider
[smithmarycss(at)rediffmail.com]
-0.0 T_RP_MATCHES_RCVD Envelope sender domain matches handover relay
domain
0.0 HTML_MESSAGE BODY: HTML included in message
0.0 HTML_FONT_SIZE_HUGE BODY: HTML font size is huge
0.0 UNPARSEABLE_RELAY Informational: message has unparseable relay lines
0.0 T_DKIM_INVALID DKIM-Signature header exists but is not valid
Subject: {SPAM?} =?utf-8?B?R29vZ2xlIGlzc3Vlcw==?=
--=_5c8857592c3d0fb6dff23e26940ec4d8
Content-Transfer-Encoding: quoted-printable
Content-Type: text/plain; charset=UTF-8
Hi
I noticed a couple of issues on your website.
Would it help if I sent screenshots?
Thanks,
Mary
--=_5c8857592c3d0fb6dff23e26940ec4d8
Content-Transfer-Encoding: quoted-printable
Content-Type: text/html; charset=UTF-8
--=_5c8857592c3d0fb6dff23e26940ec4d8--
X-Mozilla-Status2: 00000000
Return-path:
Envelope-to: dave@doctor.nl2k.ab.ca
Delivery-date: Fri, 17 Apr 2026 10:54:00 -0600
Received: from doctor by doctor.nl2k.ab.ca with local (Exim 4.98.2 (FreeBSD))
(envelope-from
id 1wDmS3-000000007wP-0oC6
for dave@doctor.nl2k.ab.ca;
Fri, 17 Apr 2026 10:53:55 -0600
Resent-From: The Doctor
Resent-Date: Fri, 17 Apr 2026 10:53:55 -0600
Resent-Message-ID:
Resent-To: Dave Yadallee
Received: from f5mail-147-121.rediffmail.com ([119.252.147.121]:45683)
by doctor.nl2k.ab.ca with esmtp (Exim 4.98.2 (FreeBSD))
(envelope-from
id 1wDl6X-0000000043m-0e5t
for sales@nk.ca;
Fri, 17 Apr 2026 09:27:45 -0600
Received: from f5mail-224-106.rediffmail.com (unknown [10.50.252.5])
by f5mail-147-121.rediffmail.com (Postfix) with ESMTP id 570CF241E48
for
X-REDIFF-Delivered-Remotely-To: sales@nk.ca
DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=rediffmail.com;
s=mail; t=1776438730;
bh=QLdR+c3iTlyCWf44z+/KD/xv3AzZDmX2LxVOsmD/iwI=;
h=MIME-Version:From:Date:Message-ID:Subject:To;
b=FC7jcL6mu4iDEuO40k2bhBHBkmedVt8/DQ8HXg7+pdfP4c8F4JQObam+NdgVQ+Se9
XYmOE6NBJqvzruLo1L0cqdjwwjw4oAYWVQ8yKbU7ZgSsCCohT9EAOAQceZTU2K262r
to4MFSN5IjQITKR8wuC0L59yNjpAJlObbB3JEnNA=
Received: (qmail 3578 invoked by uid 510); 17 Apr 2026 15:12:10 -0000
x-m-msg: 5b78c3f67c9fe5a627a324586b999f93; a6da7d6asas6dasd77; 5dad65ad5sd;
X-OUT-VDRT-SpamState: 0\LEGIT
X-OUT-VDRT-SpamScore: 50
X-OUT-VDRT-SpamCause: "gggruggvucftvghtrhhoucdtuddrgeefuddrtddtucetufdoteggodetrfdotffvucfrrhhofhhilhgvmecutffgfffkhffhnecuuegrihhlohhuthemuceftddtnecuogeurggujfhtmhhlqddqufhushhpvggtthdqfghntghlohhsvgguvfgrghdqsfculdehtddmnecujfgurhepffggvffkshfuhfgtsegrtderredttdejnecuhfhrohhmpedfofgrrhihfdcuoehsmhhithhhmhgrrhihtghsshesrhgvughifhhfmhgrihhlrdgtohhmqeenucggtffrrghtthgvrhhnpeeuuddttdefjeeggeefhfelkeduveegfeeljeffveeitdffgedtkeefgeejgfekueenucfkphepudehvddrheekrddufedvrddugeefnecuvehluhhsthgvrhfuihiivgepieenucfrrghrrghmpehmrghilhhfrhhomhepshhmihhthhhmrghrhigtshhssehrvgguihhffhhmrghilhdrtghomhdpnhgspghrtghpthhtohephedpmhhouggvpehsmhhtphhouhhtpdhrtghpthhtoheprggshhhishhhvghkrdhkuhhmrghrrdgsihhgshhtohhnvghsvghosehgmhgrihhlrdgtohhmpdhrtghpthhtoheplffqjgeslffqjgffkfetpfetvffttegggffnrdevqffopdhrtghpthhtoheprghlihhsshhonhdrlhgvmhgrihhrvgesphgrthhiohgurhhumhhmohhnugdrtghomhdprhgtphhtthhopehinhhfohesthhhrhgvvghkihhnghhsshhpihhrihhtshdrtggrpdhrtghpthhtohepohhffhhitggvrggumhhinhesghhrrghnuggvrgh
irhhsohhluhhtihhonhhsrdgtohhm"
X-Dedup-Identifier: 1776438730_3577_3576_f5-224-106
Date: 17 Apr 2026 15:12:10 -0000
MIME-Version: 1.0
To: "abhishekkumarbigston seo "
Received: from unknown 152.58.132.143 by rediffmail.com via HTTP; 17 Apr 2026
15:12:10 -0000
Message-ID: <20260417204210.1776438730.3543@f5-224-106>
Sender: smithmarycss@rediffmail.com
Sensitivity:
Subject: =?utf-8?B?R29vZ2xlIGlzc3Vlcw==?=
From: "Mary"
Content-Type: multipart/alternative;
boundary="=_5c8857592c3d0fb6dff23e26940ec4d8"
X-Spam_score: 5.7
X-Spam_score_int: 57
X-Spam_bar: +++++
X-Spam_report: Spam detection software, running on the system "doctor.nl2k.ab.ca",
has identified this incoming email as possible spam. The original
message has been attached to this so you can view it or label
similar future email. If you have any questions, see
@@CONTACT_ADDRESS@@ for details.
Content preview: Hi I noticed a couple of issues on your website. Would it
help if I sent screenshots?
Content analysis details: (5.7 points, 5.0 required)
pts rule name description
---- ---------------------- --------------------------------------------------
1.5 RCVD_IN_AHBL RBL: AHBL: sender is listed in dnsbl.ahbl.org
[119.252.147.121 listed in dnsbl.ahbl.org]
[119.252.147.121 listed in dnsbl.ahbl.org]
[119.252.147.121 listed in dnsbl.ahbl.org]
[119.252.147.121 listed in dnsbl.ahbl.org]
1.5 RCVD_IN_AHBL_SPAM RBL: AHBL: Spam Source in dnsbl.ahbl.org
[119.252.147.121 listed in dnsbl.ahbl.org]
0.5 RCVD_IN_AHBL_SMTP RBL: AHBL: Open SMTP relay in dnsbl.ahbl.org
[119.252.147.121 listed in dnsbl.ahbl.org]
0.5 RCVD_IN_AHBL_PROXY RBL: AHBL: Open Proxy server in dnsbl.ahbl.org
[119.252.147.121 listed in dnsbl.ahbl.org]
0.0 RCVD_IN_AHBL_RTB RBL: AHBL: Real-Time Blocked in dnsbl.ahbl.org
[119.252.147.121 listed in dnsbl.ahbl.org]
1.0 RCVD_IN_WSFF RBL: Received via a relay in will-spam-for-food.eu.org
[119.252.147.121 listed in will-spam-for-food.eu.org]
[119.252.147.121 listed in will-spam-for-food.eu.org]
[119.252.147.121 listed in will-spam-for-food.eu.org]
[119.252.147.121 listed in will-spam-for-food.eu.org]
[119.252.147.121 listed in will-spam-for-food.eu.org]
[119.252.147.121 listed in will-spam-for-food.eu.org]
[119.252.147.121 listed in will-spam-for-food.eu.org]
[119.252.147.121 listed in will-spam-for-food.eu.org]
-0.0 SPF_PASS SPF: sender matches SPF record
0.5 NO_RDNS Sending MTA has no reverse DNS (Postfix variant)
0.2 MR_NOT_ATTRIBUTED_IP Beta rule: an non-attributed IPv4 found in
headers
0.0 FREEMAIL_FROM Sender email is commonly abused enduser mail provider
[smithmarycss(at)rediffmail.com]
-0.0 T_RP_MATCHES_RCVD Envelope sender domain matches handover relay
domain
0.0 HTML_MESSAGE BODY: HTML included in message
0.0 HTML_FONT_SIZE_HUGE BODY: HTML font size is huge
0.0 UNPARSEABLE_RELAY Informational: message has unparseable relay lines
0.0 T_DKIM_INVALID DKIM-Signature header exists but is not valid
Subject: {SPAM?} =?utf-8?B?R29vZ2xlIGlzc3Vlcw==?=
--=_5c8857592c3d0fb6dff23e26940ec4d8
Content-Transfer-Encoding: quoted-printable
Content-Type: text/plain; charset=UTF-8
Hi
I noticed a couple of issues on your website.
Would it help if I sent screenshots?
Thanks,
Mary
--=_5c8857592c3d0fb6dff23e26940ec4d8
Content-Transfer-Encoding: quoted-printable
Content-Type: text/html; charset=UTF-8
=3D"background:white">
t-family:Calibri,sans-serif">
=3D"font-family:"Calibri Light",sans-serif">
#222222">Hi
=3D"background:white">
t-family:Calibri,sans-serif">
=3D"font-family:"Calibri Light",sans-serif">
#222222">I noticed a couple of issues on your website.=
=3D"background:white">
t-family:Calibri,sans-serif">
=3D"font-family:"Calibri Light",sans-serif">
#222222">Would it help if I sent screenshots?=
span>
=3D"background:white">
t-family:Calibri,sans-serif">
=3D"font-family:"Calibri Light",sans-serif">
#222222">Thanks,
Mary
--=_5c8857592c3d0fb6dff23e26940ec4d8--

