Baiting spam from Comcast



Delivery-date: Thu, 28 Apr 2022 14:13:00 -0600

Received: from doctor by with local (Exim 4.95 (FreeBSD))

(envelope-from )

id 1nkAUx-0003JI-BK


Thu, 28 Apr 2022 14:12:23 -0600

Resent-From: The Doctor

Resent-Date: Thu, 28 Apr 2022 14:12:23 -0600


Resent-To: Dave Yadallee

Received: from ([]:57275)

by with esmtps (TLS1.2) tls TLS_ECDHE_RSA_WITH_AES_256_GCM_SHA384

(Exim 4.95 (FreeBSD))

(envelope-from )

id 1nk6TM-0007nR-VB


Thu, 28 Apr 2022 09:54:32 -0600

Received: from ([])

by with ESMTP

id k4UlnMkCNuCfIk6SznlWUB; Thu, 28 Apr 2022 15:54:05 +0000

DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed;;

s=20190202a; t=1651161245;










Received: from ([])

by with ESMTPA

id k6RAnAusrgVYIk6SpnDu7B; Thu, 28 Apr 2022 15:54:02 +0000

X-Xfinity-VAAS: gggruggvucftvghtrhhoucdtuddrgedvfedrudejgdeliecutefuodetggdotefrodftvfcurfhrohhfihhlvgemucevohhmtggrshhtqdftvghsihdpqfgfvfdppffquffrtefokffrnecuuegrihhlohhuthemuceftddunecunecujfgurheptgfghfggfffukffvofesthejmhdthhdtvdenucfhrhhomhepfdftihgthhgrrhguucghihhltghogidpucevrhdfuceorhhitghhfiigsegtohhmtggrshhtrdhnvghtqeenucggtffrrghtthgvrhhnpedvgeegffeiuddvkeffvdfffffhteelgfduueeftdevvdffkeevveehhfektedvfeenucfkphepudefiedrudeggedrudelrddukeenucfuphgrmhfkphfpvghtfihorhhkpedufeeirddugeegrdduledrudeknecuvehluhhsthgvrhfuihiivgepudenucfrrghrrghmpehhvghlohepshhmthhptghlihgvnhhtrdgrphhplhgvpdhinhgvthepudefiedrudeggedrudelrddukedpmhgrihhlfhhrohhmpehrihgthhifgiestghomhgtrghsthdrnhgvthdpnhgspghrtghpthhtohepuddprhgtphhtthhopehrohhothesnhhkrdgtrg

X-Xfinity-VMeta: sc=0.00;st=legit

Content-Type: text/plain; charset=us-ascii

Content-Transfer-Encoding: 7bit

From: "Richard Wilcox, Cr"

Mime-Version: 1.0 (1.0)

Date: Thu, 28 Apr 2022 18:53:54 +0300

Subject: Dave Yadallee

Message-Id: <>


X-Mailer: iPhone Mail (19E258)


I'm I contacting Dave Yadallee ?

Let me know if you receive my email.

Best wishes,


Sent from my Iphone

Comcast Phish

From - Mon Apr 29 10:20:43 2013

X-Account-Key: account1

X-UIDL: 000017854f5d9180

X-Mozilla-Status: 0001

X-Mozilla-Status2: 00000000





Received: from ( [])

(using TLSv1 with cipher AES128-SHA (128/128 bits))

(No client certificate requested)

by (Postfix) with ESMTPS id BFD6312CFA82

for ; Sun, 28 Apr 2013 06:32:19 -0600 (MDT)

Received: from ( by ( with Microsoft SMTP Server (TLS) id

14.2.318.4; Sun, 28 Apr 2013 14:32:12 +0200

Received: from ( by ( with Microsoft SMTP Server (TLS) id

14.2.318.4; Sun, 28 Apr 2013 14:32:06 +0200

Message-ID: <28EAEE931CA04B15A39FBE95651AD654@oqfn>

Reply-To: "HM Revenue & Customs "

From: "HM Revenue & Customs "

Subject: [Norton AntiSpam]Tax Refund Notification !!!

Date: Sun, 28 Apr 2013 13:30:54 +0100

MIME-Version: 1.0

Content-Type: multipart/alternative;


X-Priority: 3

X-MSMail-Priority: Normal

X-Mailer: Microsoft Windows Live Mail 14.0.8089.726

X-MimeOLE: Produced By Microsoft MimeOLE V14.0.8089.726

To: Undisclosed recipients:;

X-Originating-IP: []

X-Virus-Scanned: clamav-milter 0.97.8-exp-debug at

X-Virus-Status: Clean

X-Antivirus: AVG for E-mail 10.0.1432 [3162/5781]

X-AVG-ID: ID4E9A8469-68B27EB6

X-Brightmail-Tracker: AAAABB16K2wdeThKHXlA+x15J/Q=


Content-Type: text/plain; charset="utf-8"

Content-Transfer-Encoding: quoted-printable

How to complain, ask for a review or make an appeal

Review process update

Review process - the first 12 months. Find out moreClaim Your Tax Refund On=


We identified an error in the calculation of your tax from the last payment=

, amounting to =C2=A3 1,400.00. In order for us to return the excess paymen=

t, we need to confirm a few extra details after which the funds will be cre=

dited to your specified bank account. Please click "Refund Me Now" below to=

claim your refund:

Refund Me Now

We are here to ensure the correct tax is paid at the right time, whether th=

is relates to payment of taxes received by the department or entitlement to=

benefits paid.

Best Regards,

HM Revenue & Customs Refund DepartmentSee also

Appeal and review news

Working and paying tax


Find a form

Complaints factsheet C/FS (PDF 67K)



No virus found in this message.

Checked by AVG -

Version: 10.0.1432 / Virus Database: 3162/5781 - Release Date: 04/28/13


No virus found in this message.

Checked by AVG -

Version: 10.0.1432 / Virus Database: 3162/5781 - Release Date: 04/28/13


Content-Type: text/html; charset="utf-8"

Content-Transfer-Encoding: quoted-printable


IGHT: 0px; FONT-FAMILY: Arial,Verdana,Helvetica; MARGIN-BOTTOM: 4px; PADDIN=

G-TOP: 0px">

style=3D"WIDTH: 765px; MARGIN-LEFT: 5px; BORDER-TOP: 1px solid; BORDER-RIGH=

T: #cccc33 1px solid">

style=3D"WIDTH: 180px; BACKGROUND: url(

col_bg.jpg) #fafaea repeat-x center bottom; FLOAT: left; TOP: -3px">


eals-promo-box.jpg); PADDING-BOTTOM: 160px; BACKGROUND-COLOR: #fafaea; PADD=


-POSITION: left bottom; COLOR: #008080; FONT-SIZE: 18px; FONT-WEIGHT: 100; =


to complain, ask for a review or make an appeal






DING-TOP: 5px">
style=3D"MARGIN-BOTTOM: 3px; BACKGROUND: none transparent scroll repeat 0% =

0%; MARGIN-LEFT: -5px; MARGIN-RIGHT: -5px"

style=3D"BORDER-BOTTOM-COLOR: rgb(223,242,242); BACKGROUND-COLOR: transpare=

nt; BORDER-TOP-COLOR: rgb(223,242,242); BORDER-RIGHT-COLOR: rgb(223,242,242=

); BORDER-LEFT-COLOR: rgb(223,242,242)"


style=3D"BORDER-BOTTOM-COLOR: rgb(223,242,242); BACKGROUND-COLOR: transpare=

nt; BORDER-TOP-COLOR: rgb(223,242,242); BORDER-RIGHT-COLOR: rgb(223,242,242=

); BORDER-LEFT-COLOR: rgb(223,242,242)"


style=3D"PADDING-LEFT: 4px; COLOR: #009999; FONT-SIZE: 12px; FONT-WEIGHT: 8=


href=3D"">Review process


Review process - the first 12 months. Find out more

style=3D"MARGIN-TOP: 3px; BACKGROUND: none transparent scroll repeat 0% 0%;=


style=3D"BORDER-BOTTOM-COLOR: rgb(223,242,242); BACKGROUND-COLOR: transpare=

nt; BORDER-TOP-COLOR: rgb(223,242,242); BORDER-RIGHT-COLOR: rgb(223,242,242=

); BORDER-LEFT-COLOR: rgb(223,242,242)"


style=3D"BORDER-BOTTOM-COLOR: rgb(223,242,242); BACKGROUND-COLOR: transpare=

nt; BORDER-TOP-COLOR: rgb(223,242,242); BORDER-RIGHT-COLOR: rgb(223,242,242=

); BORDER-LEFT-COLOR: rgb(223,242,242)"


style=3D"MARGIN-TOP: 3px; BACKGROUND: none transparent scroll repeat 0% 0%;=


style=3D"BORDER-BOTTOM-COLOR: rgb(250,250,234); BACKGROUND-COLOR: transpare=

nt; BORDER-TOP-COLOR: rgb(250,250,234); BORDER-RIGHT-COLOR: rgb(250,250,234=

); BORDER-LEFT-COLOR: rgb(250,250,234)"


style=3D"BORDER-BOTTOM-COLOR: rgb(250,250,234); BACKGROUND-COLOR: transpare=

nt; BORDER-TOP-COLOR: rgb(250,250,234); BORDER-RIGHT-COLOR: rgb(250,250,234=

); BORDER-LEFT-COLOR: rgb(250,250,234)"


style=3D"BORDER-BOTTOM: medium none; BORDER-LEFT: medium none; PADDING-BOTT=


OP: medium none; BORDER-RIGHT: medium none; PADDING-TOP: 0px">

Claim =


Tax Refund Online

We identified an error in the calculation of y=

our tax

from the last payment, amounting to =C2=A3 1,400.00. In order for us to ret=

urn the

excess payment, we need to confirm a few extra details after which the fund=


will be credited to your specified bank account. Please click "Refund Me No=


below to claim your refund:

style=3D"COLOR: #009999; FONT-WEIGHT: bold; TEXT-DECORATION: none"

href=3D"">Refund Me Now

We are here to ensure the correct tax is paid =

at the

right time, whether this relates to payment of taxes received by the depart=


or entitlement to benefits paid.

Best Regards,
HM Revenue & Customs Refu=



style=3D"PADDING-BOTTOM: 0px; MARGIN: 0px; PADDING-LEFT: 0px; WIDTH: 150px;=



G-TOP: 0px">

style=3D"BORDER-BOTTOM: #cccc33 1px solid; MARGIN: 0px 0px 0px 204px; HEIGH=

T: 1px; CLEAR: both; FONT-SIZE: 0em; PADDING-TOP: 24px">

style=3D"PADDING-BOTTOM: 0.9em; BACKGROUND-COLOR: #008080; MARGIN-TOP: 10px=

; PADDING-LEFT: 1em; WIDTH: 770px; FONT-FAMILY: Arial,Helvetica,sans-serif;=

COLOR: #ffffff; FONT-SIZE: 0.85em; BORDER-TOP: #666666 1px solid; PADDING-=

TOP: 0.4em">

title=3D"Business Link" alt=3D"Business Link"


-- InstanceEnd -->

=3D"avgcert" align=3D"left" color=3D"#000000">No virus found in this messag=


Checked by AVG -

Version: 10.0.1432 / Virus Database: 3162/5781 - Release Date: 04/28/13


t" color=3D"#000000">No virus found in this message.

Checked by AVG -

Version: 10.0.1432 / Virus Database: 3162/5781 - Release Date: 04/28/13



More order Spam from Comcast

From - Fri Apr 26 08:59:31 2013

X-Account-Key: account1

X-UIDL: 0000171d4f5d9180

X-Mozilla-Status: 0001

X-Mozilla-Status2: 00000000


X-AVG: Scanning

X-AVG: Scanning




Received: from ( [])

(using TLSv1 with cipher DHE-RSA-AES256-SHA (256/256 bits))

(No client certificate requested)

by (Postfix) with ESMTPS id 7CBB012CFABF

for ; Thu, 25 Apr 2013 17:50:27 -0600 (MDT)

Received: from ([]:2317 helo=User)

by with esmtpa (Exim 4.80)

(envelope-from )

id 1UVVvM-0002f5-JH; Fri, 26 Apr 2013 01:50:08 +0200


From: "Yachong trading Co"

Subject: NEW ORDER

Date: Thu, 25 Apr 2013 16:46:31 -0700

MIME-Version: 1.0

Content-Type: multipart/mixed;


X-Priority: 3

X-MSMail-Priority: Normal

X-Mailer: Microsoft Outlook Express 6.00.2600.0000

X-MimeOLE: Produced By Microsoft MimeOLE V6.00.2600.0000

X-AntiAbuse: This header was added to track abuse, please include it with any abuse report

X-AntiAbuse: Primary Hostname -

X-AntiAbuse: Original Domain -

X-AntiAbuse: Originator/Caller UID/GID - [47 12] / [47 12]

X-AntiAbuse: Sender Address Domain -

X-Get-Message-Sender-Via: authenticated_id:




X-Virus-Scanned: clamav-milter 0.97.8-exp-debug at

X-Virus-Status: Clean

X-Antivirus: AVG for E-mail 10.0.1432 [3162/5774]


X-Brightmail-Tracker: AAAABBrot4ERrD9lHXpLZx16S4A=

X-Brightmail-Tracker: AAAAAA==

This is a multi-part message in MIME format.


Content-Type: text/plain;


Content-Transfer-Encoding: 7bit


Our customer has decided to place a trial order and after confirming your quality, will place a bigger order subsequently.However, we look forward doing good business with you in the nearest future.Provide give me rock bottom price and send final quote/Proforma Invoice immediately.


Kenny Chen

International Trade Manager

Yachong trading Co


Content-Type: multipart/alternative;



Content-Type: text/plain; x-avg=cert; charset="Windows-1251"

Content-Transfer-Encoding: quoted-printable

Content-Disposition: inline

Content-Description: "Certification"


Viruses found in the attached files.

* Trojan horse Generic32.CBEF. The attachment was moved to the V=

irus Vault.

Checked by AVG -

Version: 10.0.1432 / Virus Database: 3162/5774 - Release Date: 04/26/13=



Content-Type: multipart/alternative;



Content-Type: text/plain; x-avg=cert; charset="Windows-1251"

Content-Transfer-Encoding: quoted-printable

Content-Disposition: inline

Content-Description: "Certification"


No virus found in this message.

Checked by AVG -

Version: 10.0.1432 / Virus Database: 3162/5774 - Release Date: 04/26/13=




More comcast spam

From Tue Sep 16 06:33:40 2008


Received: from

by (8.14.3/8.14.3) with SMTP id m8GCWavo022414

for ; Tue, 16 Sep 2008 06:32:43 -0600 (MDT)

Message-Id: <>

X-Spam-Filter: by

Received: from ([])

by with comcast

id FPiD1a0070bG4ec56QYbVp; Tue, 16 Sep 2008 12:32:35 +0000

Received: from ([])

by with comcast

id FQYE1a00X0QokPb3PQYLZv; Tue, 16 Sep 2008 12:32:30 +0000

X-Authority-Analysis: v=1.0 c=1 a=PjWAzMSBAAAA:8 a=qoS0ubexNZQcUMEZfLgA:9

a=U9RTHUWn66hjKH1YaAz7r4YvDHYA:4 a=a9XVJbL92GoA:10 a=WwLHQHi7AAAA:8

a=F7aakFwK2xAnoNl0nxEA:9 a=3CjEJcC80WIGw3Rkk5YA:7

a=F3Exr8Jel7Xhl-qI_RKPtw2Vb5kA:4 a=Sz-0p1zU2dQA:10

From: the easiest way to make money on the internet!

To: doctor

Subject: {?} New message

Date: Tue, 16 Sep 2008 08:31:55 -0400

MIME-Version: 1.0

Content-Type: multipart/alternative;


X-NetKnow-InComing-4-71-10-1-MailScanner-Information: Please contact the ISP

for more information

X-NetKnow-InComing-4-71-10-1-MailScanner-ID: m8GCWavo022414

X-NetKnow-InComing-4-71-10-1-MailScanner: Found to be clean

X-NetKnow-InComing-4-71-10-1-MailScanner-IP-Protocol: IPv4

X-NetKnow-InComing-4-71-10-1-MailScanner-SpamCheck: spam,


SpamAssassin (not cached, score=11.65, required 5, BAYES_50 0.00,




X-NetKnow-InComing-4-71-10-1-MailScanner-SpamScore: sssssssssss




X-Spam-Status: Yes

Content-Type: text/plain;


Content-Transfer-Encoding: 8bit

"Now You Can Add Just 1 Simple String of

Code to Any Website & Magically Money

Starts Pouring Into Your Pocket!"

"This has got to be the easiest way to make

money on the entire Internet!"

It takes just 5 minutes to add to your website or webpages and

requires NO effort beyond that at all!

Just add this "magic code"now ...

Once added, you just sit back and let the money just start pouring into your




This message has been scanned for viruses and

dangerous content by MailScanner, and is

believed to be clean.

More Nigerian Lottery Comcast Spam

From - Sun Sep 14 11:47:29 2008

X-Account-Key: account2

X-UIDL: :n4!!W~1"!bHM!!:KB"!

X-Mozilla-Status: 0001

X-Mozilla-Status2: 00000000



Received: from

by (8.14.3/8.14.3) with SMTP id m8E7jUuf007045

for ; Sun, 14 Sep 2008 01:45:37 -0600 (MDT)

X-Spam-Filter: by

Received: from ([])

by with comcast

id EXlV1a00V0cZkys5AXlVtp; Sun, 14 Sep 2008 07:45:29 +0000

Received: from ([])

by with comcast

id EXlT1a0063foy503WXlUDH; Sun, 14 Sep 2008 07:45:29 +0000

X-Authority-Analysis: v=1.0 c=1 a=wJ3G0HNx_-KJ-FWpeKoA:9

a=B5bnC6UrRe6EviKtn67YG6WbBVwA:4 a=EfJqPEOeqlMA:10 a=fN4731bYgn8A:10

Received: from [] by;

Sun, 14 Sep 2008 07:45:27 +0000


Subject: {?} Contact Mr.Pepe

Date: Sun, 14 Sep 2008 07:45:27 +0000

Message-Id: <>

X-Mailer: AT&T Message Center Version 1 (Oct 30 2007)

X-Authenticated-Sender: dml0dG9yaW9fZm91bmRhdGlvbjg5MkBjb21jYXN0Lm5ldA==

MIME-Version: 1.0

X-NetKnow-InComing-4-71-10-1-MailScanner-Information: Please contact the ISP for more information

X-NetKnow-InComing-4-71-10-1-MailScanner-ID: m8E7jUuf007045

X-NetKnow-InComing-4-71-10-1-MailScanner: Found to be clean

X-NetKnow-InComing-4-71-10-1-MailScanner-IP-Protocol: IPv4

X-NetKnow-InComing-4-71-10-1-MailScanner-SpamCheck: spam,


SpamAssassin (score=16.292, required 5, autolearn=spam,



X-NetKnow-InComing-4-71-10-1-MailScanner-SpamScore: ssssssssssssssss


X-NetKnow-InComing-4-71-10-1-MailScanner-Watermark: 1221810338.97119@UZhQPSedf/05oZNNWM1cdw

X-Spam-Status: Yes

X-UIDL: :n4!!W~1"!bHM!!:KB"!

vittorio foundation has just granted you a cash price of $450,000.00 USD contact Mr. pepe for more information on your grant


This message has been scanned for viruses and

dangerous content by MailScanner, and is

believed to be clean.

More Lottery Comcast Spam

From Sun Sep 14 03:01:58 2008


Received: from

by (8.14.3/8.14.3) with SMTP id m8E8xbCh020059

for ; Sun, 14 Sep 2008 02:59:44 -0600 (MDT)

X-Spam-Filter: by

Received: from ([])

by with ESMTP


<>; Sun, 14 Sep 2008 08:59:35 +0000

Received: from nskntwebs05p ([]) by

with ESMTP

id <>;

Sun, 14 Sep 2008 08:59:35 +0000

Received: from by; Sun, 14 Sep 2008

8:59:34 +0000

Message-ID: <12757432.1221382775179.JavaMail.root@nskntwebs05p>

Date: Sun, 14 Sep 2008 18:59:34 +1000



Subject: {?}

Mime-Version: 1.0

Content-Type: text/plain; charset=utf-8

Content-Transfer-Encoding: 7bit

X-Priority: 3 (Normal)

Sensitivity: Normal

X-Originating-IP: from by; Sun, 14 Sep

2008 8:59:34 +0000

X-RPD-ScanID: Class unknown; VirusThreatLevel unknown, RefID


X-NetKnow-InComing-4-71-10-1-MailScanner-Information: Please contact the ISP

for more information

X-NetKnow-InComing-4-71-10-1-MailScanner-ID: m8E8xbCh020059

X-NetKnow-InComing-4-71-10-1-MailScanner: Found to be clean

X-NetKnow-InComing-4-71-10-1-MailScanner-IP-Protocol: IPv4

X-NetKnow-InComing-4-71-10-1-MailScanner-SpamCheck: spam,

SpamAssassin (not cached, score=6.654, required 5, BAYES_99 3.50,


X-NetKnow-InComing-4-71-10-1-MailScanner-SpamScore: ssssss




X-Spam-Status: Yes

This is to inform you that you have emerged a lucky winner in the IRISH

LOTTERY Award to recieve the payout sum of 1,350,000.00Pounds You are

advice to file for your claims immediately.

Contact Person: Mr. Brown J. Williams

Direct Number: +44 703 180 7571

+44 703 195 5676

Claims Requirement:

1. Full Name:

2. Nationality:

3. Telephone:

4. Fax:

5. Residential Address:

6. Occupation:

7. Marital Status:

Dr. carl Moore.

(Information Officer)


This message has been scanned for viruses and

dangerous content by MailScanner, and is

believed to be clean.

More comcast spam

From - Sat Sep 13 20:55:59 2008

X-Account-Key: account2

X-UIDL: o+=!!RCM"!9`?!!i<6"!

X-Mozilla-Status: 0001

X-Mozilla-Status2: 00000000



Received: from

by (8.14.3/8.14.3) with ESMTP id m8DKl51d014543

for ; Sat, 13 Sep 2008 14:47:11 -0600 (MDT)

Received: (from root@localhost)

by (8.14.3/8.14.3/Submit) id m8DKl5ec014542

for; Sat, 13 Sep 2008 14:47:05 -0600 (MDT)


Resent-Date: Sat, 13 Sep 2008 14:47:05 -0600

Resent-Message-ID: <>

Resent-To: Dave Yadallee

Received: from

by (8.14.3/8.14.3) with SMTP id m8DKCCHn004345

for ; Sat, 13 Sep 2008 14:12:19 -0600 (MDT)

X-Spam-Filter: by

Message-ID: <000801c915dd$07327d6f$fbcbe4ab@cvemp>

From: "judas aylmer"


Subject: {?} scott mindy earl

Date: Sat, 13 Sep 2008 18:24:48 +0000

MIME-Version: 1.0

Content-Type: text/plain;


Content-Transfer-Encoding: 7bit

X-Priority: 3

X-MSMail-Priority: Normal

X-Mailer: Microsoft Outlook Express 6.00.2720.3000

X-MimeOLE: Produced By Microsoft MimeOLE V6.00.2727.1300

X-NetKnow-InComing-4-71-10-1-MailScanner: Found to be clean, Found to be clean

X-Spam-Status: Yes, No

X-NetKnow-InComing-4-71-10-1-MailScanner-Information: Please contact the ISP for more information

X-NetKnow-InComing-4-71-10-1-MailScanner-ID: m8DKl51d014543

X-NetKnow-InComing-4-71-10-1-MailScanner-IP-Protocol: IPv4


X-NetKnow-InComing-4-71-10-1-MailScanner-Watermark: 1221770831.64079@30kHoXvkyGmVWnw9kH7wvA

X-UIDL: o+=!!RCM"!9`?!!i<6"!

sylveste becket sydney


xi fasihudd


conrad judas

aylmer basil


This message has been scanned for viruses and

dangerous content by MailScanner, and is

believed to be clean.

More comcast spam

From - Sat Sep 13 20:56:01 2008

X-Account-Key: account2

X-UIDL: 5FN!!)Z*"!-^&!!/h7!!

X-Mozilla-Status: 0001

X-Mozilla-Status2: 00000000



Received: from

by (8.14.3/8.14.3) with ESMTP id m8DKlLlf014653

for ; Sat, 13 Sep 2008 14:47:27 -0600 (MDT)

Received: (from root@localhost)

by (8.14.3/8.14.3/Submit) id m8DKlLgM014652

for; Sat, 13 Sep 2008 14:47:21 -0600 (MDT)


Resent-Date: Sat, 13 Sep 2008 14:47:21 -0600

Resent-Message-ID: <>

Resent-To: Dave Yadallee

Received: from

by (8.14.3/8.14.3) with SMTP id m8DKCci0004485

for ; Sat, 13 Sep 2008 14:12:44 -0600 (MDT)

X-Spam-Filter: by

Message-ID: <000601c915dd$0619a243$092fc688@gptuap>

From: "oliver ambrose"


Subject: {?} lemuel garner dong

Date: Sat, 13 Sep 2008 18:25:16 +0000

MIME-Version: 1.0

Content-Type: text/plain;


Content-Transfer-Encoding: 7bit

X-Priority: 3

X-MSMail-Priority: Normal

X-Mailer: Microsoft Outlook Express 6.00.2720.3000

X-MimeOLE: Produced By Microsoft MimeOLE V6.00.2727.1300

X-NetKnow-InComing-4-71-10-1-MailScanner: Found to be clean, Found to be clean

X-NetKnow-InComing-4-71-10-1-MailScanner-SpamScore: ss

X-Spam-Status: Yes, No

X-NetKnow-InComing-4-71-10-1-MailScanner-Information: Please contact the ISP for more information

X-NetKnow-InComing-4-71-10-1-MailScanner-ID: m8DKlLlf014653

X-NetKnow-InComing-4-71-10-1-MailScanner-IP-Protocol: IPv4


X-NetKnow-InComing-4-71-10-1-MailScanner-Watermark: 1221770849.03279@XI2M1dpCyJmepNqDRI24oQ

X-UIDL: 5FN!!)Z*"!-^&!!/h7!!

friedric kenelm noah


jonah orazio


chan oliver

ambrose quennell


This message has been scanned for viruses and

dangerous content by MailScanner, and is

believed to be clean.

More Lottery Comcast Spam

From - Sun Apr 13 15:32:39 2008

X-Account-Key: account2

X-UIDL: )cA"!h8\"!1E8"!k_^!!

X-Mozilla-Status: 0001

X-Mozilla-Status2: 00000000


X-NetKnow-InComing-4688-1-MailScanner-Watermark: 1208532157.36786@NOFV+D+cbnhJE82RO/gTGA


Received: from

by (8.14.2/8.14.2) with SMTP id m3DFMIaW006993

for ; Sun, 13 Apr 2008 09:22:36 -0600 (MDT)

X-Spam-Filter: by

Received: from ([])

by with comcast

id D2Nn1Z01Q0QuhwU5404200; Sun, 13 Apr 2008 15:20:34 +0000

Received: from ([])

by with comcast

id D3NB1Z00B2TRPFQ3N00000; Sun, 13 Apr 2008 15:22:17 +0000

X-Authority-Analysis: v=1.0 c=1 a=uM+JWDwkKxn3Jst1B92kog==:17

a=2FUBGB1bYQpMhSFTYf4A:9 a=32Kn9ZP4S0ddJ__iQi4A:7

a=GK2nf57nkx_8UQYV8tyxo8upKCkA:4 a=kSaEKQKjsB4A:10 a=MSl-tDqOz04A:10


Received: from [] by;

Sun, 13 Apr 2008 15:22:11 +0000

From: (Lg Prize Administrator)

Subject: ATTN; Winner

Date: Sun, 13 Apr 2008 15:22:11 +0000

Message-Id: <>

X-Mailer: AT&T Message Center Version 1 (Oct 30 2007)

X-Authenticated-Sender: YXdhcmQuMDNAY29tY2FzdC5uZXQ=

MIME-Version: 1.0

X-NetKnow-InComing-4688-1-MailScanner-Information: Please contact the ISP for more information

X-MailScanner-ID: m3DFMIaW006993

X-NetKnow-InComing-4688-1-MailScanner: Found to be clean

X-NetKnow-InComing-4688-1-MailScanner-SpamScore: ssss


X-Spam-Status: No

X-UIDL: )cA"!h8\"!1E8"!k_^!!

LG House, 250 Bath Road,

Slough, Berkshire, SL1 4DX

United Kingdom.

ATTN; Winner

This email address has brought you an unexpected luck, please read through this message. Your

e-mail address was selected and confirmed by latest LG ELECTRONICS BALLOTING SYSTEM designed by LG TECHNICAL SERVICE DEPARTMENT.You hereby have been approved the total sum of 1,000,000.00(ONE

MILLION GREAT BRITISH POUNDS) cash, Credited to file ref LGE/UK 110241/01 Ticket number 1110008342 and Serial number 6028808.This is part of our international promotions program which is conducted yearly to promote the LG product with the world as a global village.The LG collects all the E-MAIL ID of the people subcribe from yahoo,hotmail,altervista and others online.we only select thirty people every Month as our winners through LG ELECTRONICS BALLOTING SYSTEM without the winner applying,we are congratulating you for having been one of the lucky people that won for this month.


Mr James Keegan (Esq).

Foreign Services Manager, Payment and Release order




PHONE: +44-703-192-5646

Congratulations once again


Dr.Harris Cook

Head Customer care Service.

ATTN; Winner

LG House, 250 Bath Road,

Slough, Berkshire, SL1 4DX

United Kingdom.

ATTN; Winner

This email address has brought you an unexpected luck, please read through this message. Your

e-mail address was selected and confirmed by latest LG ELECTRONICS BALLOTING SYSTEM designed by LG TECHNICAL SERVICE DEPARTMENT.You hereby have been approved the total sum of 1,000,000.00(ONE

MILLION GREAT BRITISH POUNDS) cash, Credited to file ref LGE/UK 110241/01 Ticket number 1110008342 and Serial number 6028808.This is part of our international promotions program which is conducted yearly to promote the LG product with the world as a global village.The LG collects all the E-MAIL ID of the people subcribe from yahoo,hotmail,altervista and others online.we only select thirty people every Month as our winners through LG ELECTRONICS BALLOTING SYSTEM without the winner applying,we are congratulating you for having been one of the lucky people that won for this month.


Mr James Keegan (Esq).

Foreign Services Manager, Payment and Release order




PHONE: +44-703-192-5646

Congratulations once again


Dr.Harris Cook

Head Customer care Service.


This message has been scanned for viruses and

dangerous content by MailScanner, and is

believed to be clean.

More Porn Comcast Spam

From - Wed Mar 19 17:50:12 2008

X-Account-Key: account2

X-UIDL: kZ*!!1~]"!\Y>"!2-]"!

X-Mozilla-Status: 0001

X-Mozilla-Status2: 00000000


X-NetKnow-InComing-4.67.3-1-MailScanner-Watermark: 1206378978.61665@h7BfTMtqdbQe7nm+2/LbtA


Received: from

by (8.14.2/8.14.2) with ESMTP id m2JHEpeH018164

for ; Wed, 19 Mar 2008 11:14:56 -0600 (MDT)

Received: (from root@localhost)

by (8.14.2/8.14.1/Submit) id m2JHEoah018162

for; Wed, 19 Mar 2008 11:14:50 -0600 (MDT)


Resent-Date: Wed, 19 Mar 2008 11:14:50 -0600

Resent-Message-ID: <>

Resent-To: Dave Yadallee

X-NetKnow-InComing-4.67.3-1-MailScanner-Watermark: 1206368054.34768@WwJSjED5IOzvTBm64QQW3w

Received: from

by (8.14.2/8.14.2) with ESMTP id m2JEDAd8022836

(version=TLSv1/SSLv3 cipher=DHE-RSA-AES256-SHA bits=256 verify=FAIL)

for ; Wed, 19 Mar 2008 08:13:16 -0600 (MDT)

X-NetKnow-OutGoing-4.67.3-1-MailScanner-Watermark: 1206367969.9724@S9hnzeHwlJImJOpvgUq5kA

Received: from

by (8.14.2/8.14.2) with ESMTP id m2JECTOa006726

for ; Wed, 19 Mar 2008 08:12:48 -0600 (MDT)

X-Spam-Filter: by

Message-ID: <000b01c889cb$4729fe80$de775e4a@CPQ10012688418>

From: "Bazerque johns"


Subject: {Spam?} 9659794

Date: Wed, 19 Mar 2008 08:12:34 -0600

MIME-Version: 1.0

Content-Type: multipart/alternative;


X-Priority: 3

X-MSMail-Priority: Normal

X-Mailer: Microsoft Outlook Express 6.00.2900.3138

X-MimeOLE: Produced By Microsoft MimeOLE V6.00.2900.3198

X-NetKnow-OutGoing-4.67.3-1-MailScanner-Information: Please contact the ISP for more information

X-NetKnow-OutGoing-4.67.3-1-MailScanner: Found to be clean

X-NetKnow-OutGoing-4.67.3-1-MailScanner-SpamCheck: spam,

SpamAssassin (not cached, score=7.318, required 1, HTML_MESSAGE 0.00,

NO_RELAYS -0.00, RAZOR2_CF_RANGE_51_100 0.50,

RAZOR2_CF_RANGE_E8_51_100 1.50, RAZOR2_CHECK 0.50, URIBL_BLACK 1.96,


X-NetKnow-OutGoing-4.67.3-1-MailScanner-SpamScore: sssssss


X-Spam-Status: Yes, No, No

X-Null-Tag: 596514b1634c3164a4653096789525a5

X-Null-Tag: ec6d83d1376a59d41d0b22b70a575bcf

X-NetKnow-InComing-4.67.3-1-MailScanner: Found to be clean, Found to be clean

X-NetKnow-InComing-4.67.3-1-MailScanner-Information: Please contact the ISP for more information

X-MailScanner-ID: m2JHEpeH018164


X-UIDL: kZ*!!1~]"!\Y>"!2-]"!


Content-Type: text/plain;


Content-Transfer-Encoding: quoted-printable

Life should be full of pleasure!

you don't believe in better se>.

This message has been scanned for viruses and

dangerous content by MailScanner, and is

believed to be clean.


This message has been scanned for viruses and

dangerous content by MailScanner, and is

believed to be clean.


Content-Type: text/html;


Content-Transfer-Encoding: quoted-printable

Life should be full of pleasure!

, and is

believed to be clean.


This message has been scanned for viruses and

dangerous content by

MailScanner, and is

believed to be clean.


More pharmacy Comcast spam

From - Sat Mar 15 19:41:29 2008

X-Account-Key: account2

X-UIDL: _Pg!!Y-!#!_?Y"!SoC"!

X-Mozilla-Status: 0001

X-Mozilla-Status2: 00000000


X-NetKnow-InComing-4.67.3-1-MailScanner-Watermark: 1206041442.64786@yzaCKNIvik9PZY1d7DO/oQ


Received: from

by (8.14.2/8.14.2) with ESMTP id m2FJTx8R003425

for ; Sat, 15 Mar 2008 13:30:25 -0600 (MDT)

X-Spam-Filter: by

Received: from [] by; Sat, 15 Mar 2008 11:30:25 -0800

Date: Sat, 15 Mar 2008 11:30:25 -0800

From: "Elba Lloyd"

X-Mailer: The Bat! (v2.00.6) Business


X-Priority: 3 (Normal)

Message-ID: <>


Subject: {?} Plus all the benefits of the first month.

MIME-Version: 1.0

Content-Type: text/plain;


Content-Transfer-Encoding: 7bit

X-Null-Tag: 85241242c1868ab5b908a5c2959fd8e8

X-NetKnow-InComing-4.67.3-1-MailScanner-Information: Please contact the ISP for more information

X-MailScanner-ID: m2FJTx8R003425

X-NetKnow-InComing-4.67.3-1-MailScanner: Found to be clean

X-NetKnow-InComing-4.67.3-1-MailScanner-SpamCheck: spam,

SpamAssassin (not cached, score=5.11, required 5, BOTNET 5.00,


X-NetKnow-InComing-4.67.3-1-MailScanner-SpamScore: sssss


X-Spam-Status: Yes

X-UIDL: _Pg!!Y-!#!_?Y"!SoC"!

Vpxl is 100% natural with no known side effects.


This message has been scanned for viruses and

dangerous content by MailScanner, and is

believed to be clean.

More porn/anatomical Comcast Spam

From - Sat Mar 15 19:41:27 2008

X-Account-Key: account2

X-UIDL: QR6"!:^Z!!:l^!!b11"!

X-Mozilla-Status: 0001

X-Mozilla-Status2: 00000000


X-NetKnow-InComing-4.67.3-1-MailScanner-Watermark: 1206041419.12488@QxPduHQRWrNo7HVAsRRPnQ


Received: from

by (8.14.2/8.14.2) with ESMTP id m2FJToiI003356

for ; Sat, 15 Mar 2008 13:30:10 -0600 (MDT)

X-Spam-Filter: by

Received: from [] by; Sat, 15 Mar 2008 11:30:11 -0800

Date: Sat, 15 Mar 2008 11:30:11 -0800

From: "Bryant Mueller"

X-Mailer: The Bat! (v2.00.2) Personal


X-Priority: 3 (Normal)

Message-ID: <>


Subject: {?} Vpxl is 100% natural with no known side effects.

MIME-Version: 1.0

Content-Type: text/plain;


Content-Transfer-Encoding: 7bit

X-Null-Tag: 76b8998a6fc74b5e2d1120f98a8e24e6

X-NetKnow-InComing-4.67.3-1-MailScanner-Information: Please contact the ISP for more information

X-MailScanner-ID: m2FJToiI003356

X-NetKnow-InComing-4.67.3-1-MailScanner: Found to be clean

X-NetKnow-InComing-4.67.3-1-MailScanner-SpamCheck: spam,

SpamAssassin (not cached, score=5.11, required 5, BOTNET 5.00,


X-NetKnow-InComing-4.67.3-1-MailScanner-SpamScore: sssss


X-Spam-Status: Yes

X-UIDL: QR6"!:^Z!!:l^!!b11"!

Size really does matter.


This message has been scanned for viruses and

dangerous content by MailScanner, and is

believed to be clean.

Comcast Spam

From - Wed Mar 12 20:19:52 2008

X-Account-Key: account2

X-UIDL: Ed2"!bpX"!Oa\"!1!8"!

X-Mozilla-Status: 0001

X-Mozilla-Status2: 00000000


X-NetKnow-InComing-4.67.3-1-MailScanner-Watermark: 1205772853.42589@+14ucMJPxHdmfoNxYS6hQw


Received: from

by (8.14.2/8.14.2) with ESMTP id m2CGrS9U012688

for ; Wed, 12 Mar 2008 10:53:34 -0600 (MDT)

Received: (from doctor@localhost)

by (8.14.2/8.14.1/Submit) id m2CGrSol012687

for; Wed, 12 Mar 2008 10:53:28 -0600 (MDT)


Resent-Date: Wed, 12 Mar 2008 10:53:27 -0600

Resent-Message-ID: <>

Resent-To: Dave Yadallee

X-NetKnow-InComing-4.67.3-1-MailScanner-Watermark: 1205772299.46584@OprNmOYw4ZK8Vy7k8bMCWg

Received: from

by (8.14.2/8.14.2) with ESMTP id m2CGiWBU009268

for ; Wed, 12 Mar 2008 10:44:52 -0600 (MDT)

X-Spam-Filter: by

Message-ID: <01c8842e$1a05aa00$e5670a18@spongy08>

From: "Shaun Tucker"


Subject: {?} InfoPath 2007

Date: Wed, 12 Mar 2008 10:44:52 -0600

MIME-Version: 1.0

Content-Type: text/plain;




Content-Transfer-Encoding: 7bit

X-Priority: 3

X-MSMail-Priority: Normal

X-Mailer: Microsoft Outlook Express 6.00.2800.1409

X-MimeOLE: Produced By Microsoft MimeOLE V6.00.2800.1409

X-Spam: Not detected

X-Null-Tag: a632e6b96c83e83d0e1b1c3d8a3ae5a7

X-Null-Tag: 646a66000ee5da521a1940ae61878cb1

X-NetKnow-InComing-4.67.3-1-MailScanner: Found to be clean, Found to be clean

X-Spam-Status: Yes, No

X-NetKnow-InComing-4.67.3-1-MailScanner-Information: Please contact the ISP for more information

X-MailScanner-ID: m2CGrS9U012688


X-UIDL: Ed2"!bpX"!Oa\"!1!8"!

Microsoft Office Enterprise 2007 includes:

Access 2007

Communicator 2007

Excel 2007

Groove 2007

InfoPath 2007

OneNote 2007

Outlook 2007

PowerPoint 2007

Publisher 2007

Word 2007

System Requirements

Intel Pentium or AMD 500 MHz processor

Microsoft Windows XP Professional or Home Edition with Service Pack 2, Windows Server 2003 with SP1

, Microsoft Windows Vista. 256 Mb of RAM

2GB of available hard-disk space.

1024x768 or higher resolution monitor

Some features require Microsoft Windows Desktop Search 3.0, Microsoft Windows Media Player 9.0, Microsoft DirectX 9.0b, Microsoft Active Sync 4.1


This message has been scanned for viruses and

dangerous content by MailScanner, and is

believed to be clean.