Web/SEO/App spam from Microsoft Outlook

X-Mozilla-Status: 0001

X-Mozilla-Status2: 00000000

Return-path:

Envelope-to: dave@doctor.nl2k.ab.ca

Delivery-date: Thu, 20 Aug 2026 13:19:00 -0600

Received: from doctor by doctor.nl2k.ab.ca with local (Exim 4.99.5 (FreeBSD))

(envelope-from )

id 1wx8Hh-00000000ACq-3CjQ

for dave@doctor.nl2k.ab.ca;

Thu, 20 Aug 2026 13:18:41 -0600

Resent-From: The Doctor

Resent-Date: Thu, 20 Aug 2026 13:18:41 -0600

Resent-Message-ID:

Resent-To: Dave Yadallee

Received: from mail-japaneastazolkn19012054.outbound.protection.outlook.com ([52.103.43.54]:16451 helo=TYPPR03CU001.outbound.protection.outlook.com)

by doctor.nl2k.ab.ca with esmtps (TLS1.3) tls TLS_AES_256_GCM_SHA384

(Exim 4.99.5 (FreeBSD))

(envelope-from )

id 1wx6Hy-00000000FEC-0GhW

for sales@nk.ca;

Thu, 20 Aug 2026 11:11:00 -0600

ARC-Seal: i=1; a=rsa-sha256; s=arcselector10001; d=microsoft.com; cv=none;

b=VDXOXMifVh01yt0z9LfutFU60wbqwaPvEFDyYkn6729N13TEntwzr5kdkbOtmBq8qY2cPDg9SLI8JmF1jwP1MN42aCfdlrPY0aiyyOqHvhdS390VzcaKIZklbZiYZWTV8onDv/yQ9tAchGNV0wgB0MHfYlxGp0FY0SgNm5iEx2a1EVex6TW80AsNT2d54Z6RQvtUivDQfu4PLn2Jx+f9ujk/XvMVb+Q3G8wqYq/UeukfmEKvvQxVzMOmHw/J7mgrKQPUDKYlvD2cRXtEgzLZzrVOGTzj/oa+aILkEYcwM+LKavxYmh3IUAMIsL4Ol6c8JzuzdGttuilWT4jStzUFpg==

ARC-Message-Signature: i=1; a=rsa-sha256; c=relaxed/relaxed; d=microsoft.com;

s=arcselector10001;

h=From:Date:Subject:Message-ID:Content-Type:MIME-Version:X-MS-Exchange-AntiSpam-MessageData-ChunkCount:X-MS-Exchange-AntiSpam-MessageData-0:X-MS-Exchange-AntiSpam-MessageData-1;

bh=XYKcl8/wZGPj2fjidittmatM5Ej7b3rYJDAnGF5afpE=;

b=NOhOu4aXzUk66kbuRV9d7Dak7P2DQn7skKnsGJzDPDHHawkPGmSYpEKHWLBwftwx8MFYfrAUP5AXMp7v8V5eQtptnJc+ZuI9IYoHfGBjgoLlG3L4iWDeHO9vcrA2wWArGqtdJUOHYnvla2dECD5o7TMudEhCDw67RLhxApchrsAtSFEeJQ4F2cLGHQPqttie+nvziPSi0HHQE3tXfrdHavS/Owujz9rBOw5xnzQsgvy7d7HqaA3eagnvR8Z6JAmtfs6GN87GoXvcbXoKArkcRYebk0sM5+kT2WqaI4gU/fgKjMSHBnJLSPmGzWKNtQPmxmfIwtLaL4N7VuUUMi4XPQ==

ARC-Authentication-Results: i=1; mx.microsoft.com 1; spf=none; dmarc=none;

dkim=none; arc=none

DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=outlook.com;

s=selector1;

h=From:Date:Subject:Message-ID:Content-Type:MIME-Version:X-MS-Exchange-SenderADCheck;

bh=XYKcl8/wZGPj2fjidittmatM5Ej7b3rYJDAnGF5afpE=;

b=XqcMymRdOHOEOQwQYu7EfR6AabFC1JnJ6Ls3LZcTnJx2QTPr3MFNlJh2z/FYLzq2+KnTF0wVrivqd0kgbEyqyTx3ELUyOfQixIdcdySgzEc6PgrcDYx4UWpGcg7NlrNJZOjgnGmBQ7BvzFGPwoNcf/lwpm07Zm3r/oe+6ICZVmNv8JK7CwXwV962Fxdn5f8KdjfXNxiuluav8QDojyNxFhmZkD6FqJ4qgmTF3+vb1K+KSx3cVpyPLwEPQh1jZjd20qGDSn+mXg7qBFSPHSPyuvpxZ6S4lDhUIXQDfm+dIKWfbGvf3yUvsxhckJ/glXHprI4WWJUePpoiXg58yMzPbg==

Received: from OS8PR04MB8301.apcprd04.prod.outlook.com (2603:1096:604:2b1::7)

by KL1PR04MB8169.apcprd04.prod.outlook.com (2603:1096:820:146::5) with

Microsoft SMTP Server (version=TLS1_2,

cipher=TLS_ECDHE_RSA_WITH_AES_256_GCM_SHA384) id 15.21.360.3; Thu, 20 Aug

2026 17:08:31 +0000

Received: from OS8PR04MB8301.apcprd04.prod.outlook.com

([fe80::222a:90f7:fe8a:2314]) by OS8PR04MB8301.apcprd04.prod.outlook.com

([fe80::222a:90f7:fe8a:2314%6]) with mapi id 15.21.0360.003; Thu, 20 Aug 2026

17:08:31 +0000

From: Michael John

Subject: We can help you-----?

Thread-Topic: We can help you-----?

Thread-Index: AQHdMMZs8DvyF9xyfEy/AZLqYctt1w==

Date: Thu, 20 Aug 2026 17:08:30 +0000

Message-ID:



Accept-Language: en-GB, en-US

Content-Language: en-GB

X-MS-Has-Attach:

X-MS-TNEF-Correlator:

msip_labels:

x-ms-publictraffictype: Email

x-ms-traffictypediagnostic: OS8PR04MB8301:EE_|KL1PR04MB8169:EE_

x-ms-office365-filtering-correlation-id: 2ea7d173-92b5-420f-4a65-08defedda8d1

x-microsoft-antispam:

BCL:0;ARA:14566002|39105399006|24021099003|31061999003|24071999003|8062599012|8060799015|19110799012|15080799012|15030799006|37011999003|55001999006|24121999003|22091999003|20031999006|25010399006|4140399003|43065399003|31055399003|40105399003|260806224601699006|2607281247196008|102099032|3412199025|440099028;

x-microsoft-antispam-message-info:

=?iso-8859-1?Q?0ZMUYrGvexA1V414eW+1J1YrJblheROPpUo4CBaQjBKgm3ZIZ4wx9XfqNZ?=

=?iso-8859-1?Q?vZo5807vMOFVwVz2xUq2CSPGpaVnBnPPnhjONwcXmzGl4WD7q3iKFuJVZi?=

=?iso-8859-1?Q?zFp+aF89LgEMlsRf8ORFYacdGEt2UGz55towMpmhpuF5L+HJAR98i+zgte?=

=?iso-8859-1?Q?gJuikpRQaisi8+pIU76xnLnuOplmqYKakjT3A05+EIi+UsDiIFDKMe34Z6?=

=?iso-8859-1?Q?TyaAmrQoH12tDP+M6RjHU1TkiOH8ZD2TrlyurYE+a3HusA1NdBZHFUIKUp?=

=?iso-8859-1?Q?JajoKdbYtJxH8nu9OL79Gqry3YvOkI1ekz/kvRVuZMIkb7r9zm0ZM0BhA7?=

=?iso-8859-1?Q?zTwaZbHGjTu5OKSbQT7+Fe8LPnxKGpyag8ZYtwqogp1W22wlXxcd1dAwP7?=

=?iso-8859-1?Q?bQv+TLdtGzytZPk2Aqe/YnS+S+5EYg4gdiGOmXK5C5/LYOUbsOicoCbdin?=

=?iso-8859-1?Q?Lxxz77Ip6yah2ZhnRKgqvGGVhTvXQP7U1rCdbfsmx/1sbkNuvdAD/1ym1c?=

=?iso-8859-1?Q?Dc+F8Lm3Fjh6kdwo+aCp98/Ib04CYpjmQmCQJQy86Hv2W0kPCGi+vg+3aa?=

=?iso-8859-1?Q?JnP4EiHIZY66LETCGWTT6jr3tpld3DVKqa1SvWcqd9bGyRW+8pKmYM7UUF?=

=?iso-8859-1?Q?lqRHUm/Gt+FQ3L8lCFRXnm96+4J4N72Jvy8eBoe6UF5f3z9D3epRIfKU3u?=

=?iso-8859-1?Q?Qpg351tZ18EX7UYyB49iSzVkEKpuiAczhadka8ko9SI0RzIslxsOtUXk2A?=

=?iso-8859-1?Q?MfQU9ArFUF0i1t25RNJnWj7XZ2Pn29ItlgVM4+Rj4nDL/lRMqeZfW2xTEM?=

=?iso-8859-1?Q?j752y/Pt2uTAQzgs9PGdfXYfdmZAsyrHfy13OGHvs82ln3KkxPkUQjaBqF?=

=?iso-8859-1?Q?DTyDSg0GkyClLH6NcC3VAWdqsb2EAebLG/8dLiYeJHUBthMdlXyk2y/VBL?=

=?iso-8859-1?Q?34IJRFvgI70+d4jqAhr5vTCzWUiZ2CwWprXmYijXdXni3cGfoeq3LsYOO/?=

=?iso-8859-1?Q?9TBYsfHfOSOhsalwqJ0IMFNSYYYeoH7rk1/jElVB44cVOD83D9aRF3k98/?=

=?iso-8859-1?Q?q2GOcMRHIhsw8jLe+JyesqSECFxyNxHGywLcgxbyqOH01zWcqTOfgQ0KVD?=

=?iso-8859-1?Q?ZlgAjB6e/d/RYoi1AkUdXL6IN8Zsagr9R2Cm39of2IjU0lk5lWidNLfwF6?=

=?iso-8859-1?Q?xR2hPtNMd7OajkoKU4s98VrEaor+u74CCrBh/I5t+fN1Kh1D2G55YSL9M7?=

=?iso-8859-1?Q?s3JByccgDBV/knghbWS/rvls9UnWhKMH6agh+oZ/MHQbJKldxiyVELIVdh?=

=?iso-8859-1?Q?XvrhZrS1vfIYbFwvLKjShQXxLw=3D=3D?=

x-ms-exchange-antispam-messagedata-chunkcount: 1

x-ms-exchange-antispam-messagedata-0:

=?iso-8859-1?Q?tiEvYE/VkCcmCikMt5JvC9zp8WfuD6xXAl9DJXysnxWhWVhlFCJOGFJecT?=

=?iso-8859-1?Q?0SBUwfCpli5AzWitvtPfHvuLqiZhn3L83OEWUnkLBBEBQGIGBQyEv5A/Qd?=

=?iso-8859-1?Q?dcvkVIhHvkkpE0wgtBTGT1oEk++j1kX2AHHa39CvD/GnzGwRih22RvpbpA?=

=?iso-8859-1?Q?dSeeEbsxpOPNznY207uFEnHi0warml/HznNLj8Tqo8zxyFGOYNy75tvWIp?=

=?iso-8859-1?Q?O6UGrSSkLlnPCQ+A0oPW1o6G+8LQaChpZDAmYDcYLAHJ4ONbDyYo5HlO6w?=

=?iso-8859-1?Q?Vf6xhwpK1mnF5lwAGpSwqpPpJC2gRzjM1mcNKbTqih0U8UgYYTu2pGTA2A?=

=?iso-8859-1?Q?rdd8KpsvysPj21fdHqOOiSmdjeaczrSRM0gIUJOQqxaRCTHrzmXYkDn1GY?=

=?iso-8859-1?Q?VAlMwzW/6CU3ZrvnC43HWfaTMYrbjYnHc0FLLQYEiDS52YORw9vmDff5r2?=

=?iso-8859-1?Q?6WNTKmmg6Ci4bkb0pxjios3BcQDQs/wkCp2tZ53b/3Wr6MYq0w1aFVBIiy?=

=?iso-8859-1?Q?5ctH7JKI6TMERYgqVqt7UQ9eIQwCBbuwVo8BR2A+bzjLBgkSx3LHI5FHhh?=

=?iso-8859-1?Q?e+TFdTXM+ZCyo7fv4yW7SQDlqdaos5M/My0IFiEvR9oMcGlLL0APaUHZBZ?=

=?iso-8859-1?Q?U3IFsPCwrrX0NvA/0rzxTgeqU/DDZLqiJQyZAuuOl5MwgBLUmSU4Yrh6Gq?=

=?iso-8859-1?Q?+5EfZU2SQ7EnOT+xWgY1tl1VJtLWfowzHSdagKGGWqpDqXy4N2cUz+KVSb?=

=?iso-8859-1?Q?ivk+zLBRkMerNPofV5mCiqEXwdgLfy2iLVyvlDRl1pkZhN1cQcfWmvGPEh?=

=?iso-8859-1?Q?nAi+q3OVKJZwVFK3cu0Sc3ddjmV5zLq2xN5Pcht2A0Jcm6FKE6RC796PZp?=

=?iso-8859-1?Q?uRRVnbQHP6cCl8aDqjUaVnBitWLgczfLTmlAa30eSAAbQrSOzwtcjPz9IK?=

=?iso-8859-1?Q?NMVnp9xjjndX8n+ikrd8IO6MXWBieVbSHhfnAiLCqwZ2OHkZKYyyqk+AGr?=

=?iso-8859-1?Q?eunpyVgtfBadIPK8KTRBDAehNJPjLg62vimM6qKopkqVN6hG+OYCk+zwRj?=

=?iso-8859-1?Q?riZo55SVr+b+FvbaG2b9Fu5SrxnmTxxMPhjOagB6ZXVrnTnjNA3gaClziw?=

=?iso-8859-1?Q?kJk35BcWIDAR5rdiTXX0DL/eArV1kBNk6TF5qQXqZeppYZqsiRUtIthuDI?=

=?iso-8859-1?Q?pH+WTPveMrX+dO3cBR5SxarWkveuigCAOonlzSMMXrtfTpnpy4+3ppA9kh?=

=?iso-8859-1?Q?eB5HAxtToOQwzAc33taebbgGQLvNxVIKfXu3vjNiT+KtXAcLSX7BVfc4fU?=

=?iso-8859-1?Q?8o21I380N7bwAZBN7nVBGqr/bybI6uMiHtc6HLHoCmohM55+ntuyx8bpQb?=

=?iso-8859-1?Q?Bd+mdVtfV64etO5OcL1AotRpirWpv6GUVG6zb7jCMnVE4OobAwMat93gDq?=

=?iso-8859-1?Q?2SfbT03cR8Oq4wqYaYBFbqAI4BcClcLFluFdKWvbiuRaiS/qqLJkNw3qKD?=

=?iso-8859-1?Q?7SBVo9VDUcTiknp5ZdLzTR?=

Content-Type: multipart/alternative;

boundary="_000_OS8PR04MB830192B5782BFFC73F16E64F8AA42OS8PR04MB8301apcp_"

MIME-Version: 1.0

X-OriginatorOrg: outlook.com

X-MS-Exchange-CrossTenant-AuthAs: Internal

X-MS-Exchange-CrossTenant-AuthSource: OS8PR04MB8301.apcprd04.prod.outlook.com

X-MS-Exchange-CrossTenant-RMS-PersistedConsumerOrg: 00000000-0000-0000-0000-000000000000

X-MS-Exchange-CrossTenant-Network-Message-Id: 2ea7d173-92b5-420f-4a65-08defedda8d1

X-MS-Exchange-CrossTenant-originalarrivaltime: 20 Aug 2026 17:08:30.5585

(UTC)

X-MS-Exchange-CrossTenant-fromentityheader: Hosted

X-MS-Exchange-CrossTenant-id: 84df9e7f-e9f6-40af-b435-aaaaaaaaaaaa

X-MS-Exchange-CrossTenant-rms-persistedconsumerorg: 00000000-0000-0000-0000-000000000000

X-MS-Exchange-Transport-CrossTenantHeadersStamped: KL1PR04MB8169



--_000_OS8PR04MB830192B5782BFFC73F16E64F8AA42OS8PR04MB8301apcp_

Content-Type: text/plain; charset="iso-8859-1"

Content-Transfer-Encoding: quoted-printable



Hi,



I found some errors on your website and would like to share them with you. =

Could I send you a screenshot to illustrate the issues?



If your answer is YES, then I will share the error report.



Thanks,



--_000_OS8PR04MB830192B5782BFFC73F16E64F8AA42OS8PR04MB8301apcp_

Content-Type: text/html; charset="iso-8859-1"

Content-Transfer-Encoding: quoted-printable








1">








Calibri, Helvetica, sans-serif; font-size: 12pt; color: rgb(0, 0, 0);">

Hi,
v>


nt, Aptos_MSFontService, Calibri, Helvetica, sans-serif; font-size: 12pt; c=

olor: rgb(0, 0, 0);">

 <=

/div>


nt, Aptos_MSFontService, Calibri, Helvetica, sans-serif; font-size: 12pt; c=

olor: rgb(0, 0, 0);">

I found some e=

rrors on your website and would like to share them with you. Could I send y=

ou a screenshot to illustrate the issues?



nt, Aptos_MSFontService, Calibri, Helvetica, sans-serif; font-size: 12pt; c=

olor: rgb(0, 0, 0);">

 <=

/div>


nt, Aptos_MSFontService, Calibri, Helvetica, sans-serif; font-size: 12pt; c=

olor: rgb(0, 0, 0);">

If your answer=

is YES, then I will share the error report.



nt, Aptos_MSFontService, Calibri, Helvetica, sans-serif; font-size: 12pt; c=

olor: rgb(0, 0, 0);">

 <=

/div>


Calibri, Helvetica, sans-serif; font-size: 12pt; color: rgb(0, 0, 0);">

Thanks,=









--_000_OS8PR04MB830192B5782BFFC73F16E64F8AA42OS8PR04MB8301apcp_--

Catalogue inquiry spam from Google Gmail

X-Mozilla-Status: 0001

X-Mozilla-Status2: 00000000

Return-path:

Envelope-to: dave@doctor.nl2k.ab.ca

Delivery-date: Thu, 20 Aug 2026 10:16:00 -0600

Received: from doctor by doctor.nl2k.ab.ca with local (Exim 4.99.5 (FreeBSD))

(envelope-from )

id 1wx5QY-00000000MOc-0xqP

for dave@doctor.nl2k.ab.ca;

Thu, 20 Aug 2026 10:15:38 -0600

Resent-From: The Doctor

Resent-Date: Thu, 20 Aug 2026 10:15:38 -0600

Resent-Message-ID:

Resent-To: Dave Yadallee

Received: from mail-wm1-f104.google.com ([209.85.128.104]:44142)

by doctor.nl2k.ab.ca with esmtps (TLS1.3) tls TLS_AES_128_GCM_SHA256

(Exim 4.99.5 (FreeBSD))

(envelope-from )

id 1wx4H0-000000007Jh-3eP2

for doctor@netknow.ca;

Thu, 20 Aug 2026 09:01:53 -0600

Received: by mail-wm1-f104.google.com with SMTP id 5b1f17b1804b1-495590dde14so27604915e9.0

for ; Thu, 20 Aug 2026 08:00:55 -0700 (PDT)

DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed;

d=nwhssasi-com.20251104.gappssmtp.com; s=20251104; t=1787238049; x=1787842849; darn=netknow.ca;

h=message-id:date:reply-to:mime-version:content-type:to:subject:from

:from:to:cc:subject:date:message-id:reply-to:content-type;

bh=YIj577gQN3gcbkCNwFCceFilc43bUo7ya+iM6grQMEk=;

b=vJqgTXacJ93xqvLkaYZopLVcFBjhdfCI4QTWcVgp/T8Yo1KExChM7IN76l5PdVfNKE

9Tw1I5qweqRqqP6AcgW0r53TlJiSAwr0qYzLSr4hnnDTe30CsIWK/IiBGzf5kY4Eu+xE

GWHaRdD3J+EUmXFFv3NQRl9DHpRatmZCAM0FXFnoSuO3U5/p8IgqPkgWwVrCnWHgyT76

QCzuwmR7kBOP0vZQ2Zbr8SaN3wB4rDAhgo3jbcweVgWTLoIUT2W8MFoWlvJ3q6qBCtCj

nZco5LposDgGWaU6zhxw8PpCGvnMepNx+m+DXiuGmenkaht5GC++bfOZoYi25DoyErmL

B2Bw==

X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed;

d=1e100.net; s=20251104; t=1787238049; x=1787842849;

h=message-id:date:reply-to:mime-version:content-type:to:subject:from

:x-gm-gg:x-gm-message-state:from:to:cc:subject:date:message-id

:reply-to:content-type;

bh=YIj577gQN3gcbkCNwFCceFilc43bUo7ya+iM6grQMEk=;

b=GVeNkHUEBmWmlta3B9cVSalybhz32Zvx9Jfxn98KfDXnl6bBatVAt9pH0m1JgWNBbq

U4IqdzVABfEnQ/3xN9ggUfGHchqNgoZriPSgToqS35NEnuC8clSBf960YlKUPWWb+16N

XIjsBLJQuRMgEvWlt0uCfKfwnnj58Q193ULw+sdp86Qr5dg4Th4NkO+lNvO8Ca3tplBY

PXQZaI0+ha/ntoSPYLlhHrIAQHAT/vyQgPI0T3IJZqJomZFMCybodfOJqBeSoKlGK1nI

3tdEGYG6utP0/fhavQLTHLHmRz2YyCc3juAIfeU8zR3S2bsmyd7AFD7FD2gP1/JnxrQC

4FvA==

X-Gm-Message-State: AOJu0YwOgLNCUjg0XBHKJK2INdcUJ07iz/2TyDWri0zvjV1CzaQXB5Qu

91sd3Z0k4fH53cS0qMJ8kmu+VtoRJsfRPuyq1rHSZSIfI3CNsfN9XsZb5qaqpzuzVniZA/TIVmW

BWyj+gl5YAtOqPP/OPLGmnkTv3QGl8q7K5BCqQkB5GZbfh20=

X-Gm-Gg: AR+sD13EEFu5Vyjw15O+P8qVJwU2+FrDmVxFrMhmdKciX5s6o9mpUQ5ipgxnitLqDGg

vEWF3tD1dsaCCC01XUrh733p7Ty02UMWJjZ0rPCEvz0DnDw7keIcZEVq5d0JKtiFcOhAy+/DaUZ

NKrdrrXFuYz6m80RyhHvqs0M8r+hgkFizATOCpNmLEYo6zROUaI4CFyljxN6BtqVXg4cmeBzd+L

No8qNNzIWFlfVjVzaqnf7UbXiCJlWRT18HpmO03bmAr0O6viJYyhIcqXzlzkChLaLLRsUdzE1AF

2LSONKBEbqQ/9ynvhSNim2uVUffF52p3kam5qnjURwAAQoRS9mHYoWWvP7XEZigO50VWpMDtonS

Lbzkeil/H8bMqaAY92Gv0nLsSsAZ7hd+K3vJfWJwwI+k=

X-Received: by 2002:a05:600c:4e55:b0:499:a07d:a482 with SMTP id 5b1f17b1804b1-499aa1a28efmr267985925e9.10.1787238048512;

Thu, 20 Aug 2026 08:00:48 -0700 (PDT)

Received: from WIN-CLVG3PFJJET (ip31-70-65-27.pbiaas.com. [31.70.65.27])

by smtp-relay.gmail.com with ESMTPS id 5b1f17b1804b1-499ad8ec7cesm17562875e9.0.2026.08.20.08.00.48

for

(version=TLS1_2 cipher=ECDHE-ECDSA-AES128-GCM-SHA256 bits=128/128);

Thu, 20 Aug 2026 08:00:48 -0700 (PDT)

X-Relaying-Domain: sasinm.com

From: "SCAFFCO CONSTRUCTION INC."

Subject: Product Sourcing Inquirry

To:

Content-Type: multipart/alternative; boundary="m7R=_uFiox8LgKUUeZilQKIUJR2vXwRpzS"

MIME-Version: 1.0

Reply-To:

Date: Thu, 20 Aug 2026 15:00:48 +0000

Message-Id: <20482026080015E6D8C46616-4D9D4164F8@sasinm.com>



This is a multi-part message in MIME format



--m7R=_uFiox8LgKUUeZilQKIUJR2vXwRpzS

Content-Type: text/plain; charset="iso-8859-1"

Content-Transfer-Encoding: quoted-printable





Good day,



I am writing to inquire about your product, Can you give me your price=

list or latest catalog if you have it. We have needs for a big order.=

Waiting for your feedback. Thanks



Regards

Bryo Evans

Email:bryon20221@gmail.com



--m7R=_uFiox8LgKUUeZilQKIUJR2vXwRpzS

Content-Type: text/html; charset="iso-8859-1"

Content-Transfer-Encoding: quoted-printable








8859-1">


le=3D1"> <=

title>Product Sourcing Inquirry



Good =

day,

I am writing to inquire about your product, Can you give me=

your price list or latest catalog if you have it. We have needs for a=

big order. Waiting for your feedback. Thanks

Regards
Bryo Ev=

ans
Email:bryon20221@gmail.com







--m7R=_uFiox8LgKUUeZilQKIUJR2vXwRpzS--



NAtional Bank of Canada PHish from Sendgrid

X-Mozilla-Status: 0001

X-Mozilla-Status2: 00000000

Return-path:

Envelope-to: dave@doctor.nl2k.ab.ca

Delivery-date: Thu, 20 Aug 2026 10:16:00 -0600

Received: from doctor by doctor.nl2k.ab.ca with local (Exim 4.99.5 (FreeBSD))

(envelope-from )

id 1wx5Q8-00000000MLC-0IfT

for dave@doctor.nl2k.ab.ca;

Thu, 20 Aug 2026 10:15:12 -0600

Resent-From: The Doctor

Resent-Date: Thu, 20 Aug 2026 10:15:11 -0600

Resent-Message-ID:

Resent-To: Dave Yadallee

Received: from s.wrqvqshf.outbound-mail.sendgrid.net ([149.72.70.15]:5446)

by doctor.nl2k.ab.ca with esmtps (TLS1.3) tls TLS_AES_128_GCM_SHA256

(Exim 4.99.5 (FreeBSD))

(envelope-from )

id 1wx3tf-0000000031k-2dzC

for doctor@nk.ca;

Thu, 20 Aug 2026 08:37:44 -0600

DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=rieyjc.com;

h=from:subject:date:mime-version:to:content-type:cc:content-type:date:

from:subject:to;

s=s1; t=1787236602;

bh=MMUWLl7PEbUK7qRn+A3ZSu1sQrc/fQknZNt7J7ZqoHs=;

b=PbePqrou2HLMY2TV5ArKYmGQqADIhf8Hizp5MagHBDuFTxlnW8wBZbRoN7V6u8APzoTv

4Qbs8e42Oi9ItlYCtQrjV7jvMP+CwbGzSP4tKH+fZeIineLMYruT37Rsts1pPOdGU3PShA

FXZwWhySNyVdDyLUb2DGsWWFsTVCcrx2raJYxUlYPER6RDLqm+ZZdQCXETbosxUAgFP9xu

8dONJ3fdbQFm46fjHFAr+u89X+Hyha/edu2UnAdbQegsj/18xcAYolmelh/15OQEvv1yp0

Uc0I9QsQI4fcwxdbUyyAajaK1968JZJJYvBkQ0NjolFJDJElW6R6viyjQbgD0ZKw==

Received: by recvd-667967d667-bmm2n with SMTP id recvd-667967d667-bmm2n-1-6A8710FA-15

2026-08-20 14:36:42.085993295 +0000 UTC m=+1971762.030328766

Received: from castelferrus.fr (unknown)

by geopod-ismtpd-9 (SG) with ESMTP

id I_N0nLD9Tbu0HJzZnHu6dA

for ;

Thu, 20 Aug 2026 14:36:41.975 +0000 (UTC)

Message-Id: <644fa0b1f0dd66a85a897a65383269f3@rieyjc.com>

From: National Bank Direct Brokerage-Support

Subject: Action Needed: Review Your Brokerage Account Information

Date: Thu, 20 Aug 2026 14:36:42 +0000 (UTC)

X-Priority: 3

X-Mailer: AHUCPMDBNW 383.8843.37327

Mime-Version: 1.0

X-SG-EID:

=?us-ascii?Q?u001=2EqSrTYuf+buIuYTIRkkJ60PaCuK8FLEKUxWjcziMBe2+9omSbt9vAfq2yq?=

=?us-ascii?Q?HqJDvTb38W+fVNoXbOjZtzhLGv9w5HEb77OV4BE?=

=?us-ascii?Q?FLXl4lNoKHljPcbzrfOteDX9Qyt5E=2F8goP5o2uX?=

=?us-ascii?Q?2A2bNRY86WcysGD6ywzi5x7Een8ZUtkoa7PTkrd?=

=?us-ascii?Q?S3VXQI57fH69ncuvgYVrPN5zFl7X3JhoPAfAk24?=

=?us-ascii?Q?He=2FDvxk1duGasGekWrMnjvrTbPHxf0AF38wQ5=2FL?=

=?us-ascii?Q?PicJQRJiA2xgXjHlmGt2HKyeHw=3D=3D?=

To: "doctor@nk.ca"

X-Entity-ID: u001.yrMYZx4YSB2QzXiC3cfc3w==

Content-Type: multipart/alternative;

boundary="90160e9f78663be140a487bf000fe451"

X-Spam_score: 28.7

X-Spam_score_int: 287

X-Spam_bar: ++++++++++++++++++++++++++++

X-Spam_report: Spam detection software, running on the system "doctor.nl2k.ab.ca",

has identified this incoming email as possible spam. The original

message has been attached to this so you can view it or label

similar future email. If you have any questions, see

@@CONTACT_ADDRESS@@ for details.



Content preview: Action Needed: Review Your Brokerage Account Information MESSAGE

CONFIRMATION Action Needed: Review Your Brokerage Account InformationDear

Client,Your brokerage account currently requires an account i [...]



Content analysis details: (28.7 points, 5.0 required)



pts rule name description

---- ---------------------- --------------------------------------------------

1.0 RCVD_IN_WSFF RBL: Received via a relay in will-spam-for-food.eu.org

[149.72.70.15 listed in will-spam-for-food.eu.org]

[149.72.70.15 listed in will-spam-for-food.eu.org]

[149.72.70.15 listed in will-spam-for-food.eu.org]

[149.72.70.15 listed in will-spam-for-food.eu.org]

[149.72.70.15 listed in will-spam-for-food.eu.org]

[149.72.70.15 listed in will-spam-for-food.eu.org]

[149.72.70.15 listed in will-spam-for-food.eu.org]

[149.72.70.15 listed in will-spam-for-food.eu.org]

1.5 RCVD_IN_AHBL RBL: AHBL: sender is listed in dnsbl.ahbl.org

[149.72.70.15 listed in dnsbl.ahbl.org]

[149.72.70.15 listed in dnsbl.ahbl.org]

[149.72.70.15 listed in dnsbl.ahbl.org]

[149.72.70.15 listed in dnsbl.ahbl.org]

0.0 RCVD_IN_AHBL_RTB RBL: AHBL: Real-Time Blocked in dnsbl.ahbl.org

[149.72.70.15 listed in dnsbl.ahbl.org]

0.5 RCVD_IN_AHBL_SMTP RBL: AHBL: Open SMTP relay in dnsbl.ahbl.org

[149.72.70.15 listed in dnsbl.ahbl.org]

1.5 RCVD_IN_AHBL_SPAM RBL: AHBL: Spam Source in dnsbl.ahbl.org

[149.72.70.15 listed in dnsbl.ahbl.org]

0.5 RCVD_IN_AHBL_PROXY RBL: AHBL: Open Proxy server in dnsbl.ahbl.org

[149.72.70.15 listed in dnsbl.ahbl.org]

-3.0 RCVD_IN_RP_CERTIFIED RBL: Sender in ReturnPath Certified - Contact

cert-sa@returnpath.net

[Excessive Number of Queries | ]

-2.0 RCVD_IN_RP_SAFE RBL: Sender in ReturnPath Safe - Contact

safe-sa@returnpath.net

[Excessive Number of Queries | ]

2.5 URIBL_DBL_SPAM Contains a spam URL listed in the DBL blocklist

[URI: rieyjc.com]

1.3 RCVD_IN_RP_RNBL RBL: Relay in RNBL,

https://senderscore.org/blacklistlookup/

[149.72.70.15 listed in bl.score.senderscore.com]

1.6 RCVD_IN_MSPIKE_L3 RBL: Low reputation (-3)

[149.72.70.15 listed in bl.mailspike.net]

-0.0 SPF_PASS SPF: sender matches SPF record

0.0 RCVD_IN_MSPIKE_BL Mailspike blacklisted

0.5 FROM_LOCAL_NOVOWEL From: localpart has series of non-vowel letters

15 GR_DOMAIN_SENDGR1 Received contains spammer id (sendgr)

0.8 ZMIvirSobY_SUB39 SPAM from Sober-Y-Virus

0.6 J_CHICKENPOX_64 BODY: 6alpha-pock-4alpha

0.6 J_CHICKENPOX_63 BODY: 6alpha-pock-3alpha

0.6 J_CHICKENPOX_37 BODY: 3alpha-pock-7alpha

1.5 MR_STRANGE_QUESTION URI: No description available.

0.0 HTML_MESSAGE BODY: HTML included in message

0.0 HTML_FONT_SIZE_HUGE BODY: HTML font size is huge

0.0 T_DKIM_INVALID DKIM-Signature header exists but is not valid

0.8 SARE_FROM_SPAM_WORD3 I don't know people named this!

1.0 ACCT_PHISHING Possible phishing for account information

1.0 XPRIO Has X-Priority header

0.9 URI_PHISH Phishing using web form

Subject: {SPAM?} Action Needed: Review Your Brokerage Account Information





Button to the BNC website



MESSAGE CONFIRMATION

Action Needed: Review Your Brokerage Account Information

Dear Client,



Your brokerage account currently requires an account information review.



Keeping your account details accurate and up to date is important for the ongoing use of your brokerage account and related services. Please verify the information registered to your account and make any necessary updates where applicable.



To complete this account task, please use the secure review page provided below: Complete Update.



Once the requested information has been submitted, the account update will be processed and reflected in your brokerage profile. You will receive notification when the review has been completed.



If the required update remains outstanding, certain account functions may be affected. This may include temporary limitations on trading, transactions, account services, or other available features.



If you have any questions regarding this request, please reach customer assistance through the official support channel.

Stay connected

Terms of use | Privacy policy | ABC's of security

© National Bank of Canada. All rights reserved. Any reproduction, in whole or in part, is strictly prohibited without the prior written consent of National Bank of Canada.



National Bank of Canada, 800 St-Jacques Street, Montreal (Quebec) H3C 1A3



nbc.ca



For options to unsubscribe, click here.





CONFIDENTIALITÉ : Ce document est destiné uniquement à la personne ou à l'entité à qui il est adressé. L'information apparaissant dans ce document est de nature légalement privilégiée et confidentielle. Si vous n'êtes pas le destinataire visé ou la personne chargée de le remettre à son destinataire, vous êtes, par la présente, avisé que toute lecture, usage, copie ou communication du contenu de ce document est strictement interdit. De plus, vous êtes prié de communiquer avec l'expéditeur sans délai et de détruire ce document immédiatement.

CONFIDENTIALITY: This document is intended solely for the individual or entity to whom it is addressed. The information contained in this document is legally privileged and confidential. If you are not the intended recipient or the person responsible for delivering it to the intended recipient, you are hereby advised that you are strictly prohibited from reading, using, copying or disseminating the contents of this document. Please inform the sender immediately and delete this document immediately.







NAtional Bank of Canda Phish from sendgrid

X-Mozilla-Status: 0001

X-Mozilla-Status2: 00000000

Return-path:

Envelope-to: dave@doctor.nl2k.ab.ca

Delivery-date: Thu, 20 Aug 2026 10:15:00 -0600

Received: from doctor by doctor.nl2k.ab.ca with local (Exim 4.99.5 (FreeBSD))

(envelope-from )

id 1wx5Pq-00000000MH8-12pj

for dave@doctor.nl2k.ab.ca;

Thu, 20 Aug 2026 10:14:54 -0600

Resent-From: The Doctor

Resent-Date: Thu, 20 Aug 2026 10:14:54 -0600

Resent-Message-ID:

Resent-To: Dave Yadallee

Received: from s.wrqvqsbb.outbound-mail.sendgrid.net ([149.72.70.187]:6838)

by doctor.nl2k.ab.ca with esmtps (TLS1.3) tls TLS_AES_128_GCM_SHA256

(Exim 4.99.5 (FreeBSD))

(envelope-from )

id 1wx3Sp-00000000LgX-1GNh

for root@nk.ca;

Thu, 20 Aug 2026 08:09:59 -0600

DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=rieyjc.com;

h=from:subject:date:mime-version:to:content-type:cc:content-type:date:

from:subject:to;

s=s1; t=1787234938;

bh=Ux0fq1jmTKu8FbDXYBIPvNOpZbMp+n4IrdVSpArl5IQ=;

b=bZYjVhteTHSwyVRev1s1CRJ4izmG/voBS4b3sGeohr1ixZYrrw6cB/mhDgJ34Rwfeg1t

PDpyKv4sI1Pbx+fNtekurpka+/9Q3BGrGXq3a9sP37WrfXVhBpsIQwCMXDSMP5iMv2zjUo

6kCSxiId5rgSe2k28GeU6td+N48z9gggSHWcQwgQxs2j0P2NhREprGpVR7uPRR5fBSbfox

/azY73wxn5n2Z5MTRuCGy5TW8PtzNgs7Oru1E5LM9P3G01bDCZKW42HlQhVkn2eZhcib7x

euJhbxrs0yyBHxkEzkdETBlbCZjQXA+GdIedC48uiGjbb/2hyrFivhRslYUem8Rg==

Received: by recvd-6cfbc786db-lqgpm with SMTP id recvd-6cfbc786db-lqgpm-1-6A870A7A-7

2026-08-20 14:08:58.041322547 +0000 UTC m=+1970202.041859720

Received: from electricien-neuilly-sur-seine.fr (unknown)

by geopod-ismtpd-11 (SG) with ESMTP id H3jRsznDRmW3C4J1HmvSJQ

for ; Thu, 20 Aug 2026 14:08:57.980 +0000 (UTC)

Message-Id: <248c021f279bd83802a8eedb08267249@rieyjc.com>

From: National Bank Direct Brokerage-Support

Subject: Action Needed: Review Your Brokerage Account Information

Date: Thu, 20 Aug 2026 14:08:58 +0000 (UTC)

X-Priority: 3

X-Mailer: GMVWE 899.54163.20155

Mime-Version: 1.0

X-SG-EID:

=?us-ascii?Q?u001=2EqSrTYuf+buIuYTIRkkJ60PaCuK8FLEKUxWjcziMBe2+9omSbt9vAfq2yq?=

=?us-ascii?Q?HqJDvTbPKCE24L5IguTXFY=2FxlogE6P6zrk5MjKZ?=

=?us-ascii?Q?+c47gPmsDRIWTF+McjDPuL7k03djWVoG3rNUDF8?=

=?us-ascii?Q?TB60FVAlWYcrTbUVEoj3RMV2G80L+m1st33+hpF?=

=?us-ascii?Q?nRiKq+H+DM=2F3UWN9=2FcMb+yaQuIHERpgLpFqbgif?=

=?us-ascii?Q?7Arf7uvG6XWoeSCMErUZu4jZj7CTD70=2F0Ntg4jC?=

=?us-ascii?Q?fZEjthfmu69TBv0rHJ0b4qO8jw=3D=3D?=

To: root

X-Entity-ID: u001.yrMYZx4YSB2QzXiC3cfc3w==

Content-Type: multipart/alternative;

boundary="324106537a241c5ea8379fdd000f1111"

X-Spam_score: 28.2

X-Spam_score_int: 282

X-Spam_bar: ++++++++++++++++++++++++++++

X-Spam_report: Spam detection software, running on the system "doctor.nl2k.ab.ca",

has identified this incoming email as possible spam. The original

message has been attached to this so you can view it or label

similar future email. If you have any questions, see

@@CONTACT_ADDRESS@@ for details.



Content preview: Action Needed: Review Your Brokerage Account Information MESSAGE

CONFIRMATION Action Needed: Review Your Brokerage Account InformationDear

Client,Your brokerage account currently requires an account i [...]



Content analysis details: (28.2 points, 5.0 required)



pts rule name description

---- ---------------------- --------------------------------------------------

1.0 RCVD_IN_WSFF RBL: Received via a relay in will-spam-for-food.eu.org

[149.72.70.187 listed in will-spam-for-food.eu.org]

[149.72.70.187 listed in will-spam-for-food.eu.org]

[149.72.70.187 listed in will-spam-for-food.eu.org]

[149.72.70.187 listed in will-spam-for-food.eu.org]

[149.72.70.187 listed in will-spam-for-food.eu.org]

[149.72.70.187 listed in will-spam-for-food.eu.org]

[149.72.70.187 listed in will-spam-for-food.eu.org]

[149.72.70.187 listed in will-spam-for-food.eu.org]

1.5 RCVD_IN_AHBL RBL: AHBL: sender is listed in dnsbl.ahbl.org

[149.72.70.187 listed in dnsbl.ahbl.org]

[149.72.70.187 listed in dnsbl.ahbl.org]

[149.72.70.187 listed in dnsbl.ahbl.org]

[149.72.70.187 listed in dnsbl.ahbl.org]

0.5 RCVD_IN_AHBL_PROXY RBL: AHBL: Open Proxy server in dnsbl.ahbl.org

[149.72.70.187 listed in dnsbl.ahbl.org]

0.5 RCVD_IN_AHBL_SMTP RBL: AHBL: Open SMTP relay in dnsbl.ahbl.org

[149.72.70.187 listed in dnsbl.ahbl.org]

1.5 RCVD_IN_AHBL_SPAM RBL: AHBL: Spam Source in dnsbl.ahbl.org

[149.72.70.187 listed in dnsbl.ahbl.org]

0.0 RCVD_IN_AHBL_RTB RBL: AHBL: Real-Time Blocked in dnsbl.ahbl.org

[149.72.70.187 listed in dnsbl.ahbl.org]

-3.0 RCVD_IN_RP_CERTIFIED RBL: Sender in ReturnPath Certified - Contact

cert-sa@returnpath.net

[Excessive Number of Queries | ]

-2.0 RCVD_IN_RP_SAFE RBL: Sender in ReturnPath Safe - Contact

safe-sa@returnpath.net

[Excessive Number of Queries | ]

2.5 URIBL_DBL_SPAM Contains a spam URL listed in the DBL blocklist

[URI: rieyjc.com]

1.3 RCVD_IN_RP_RNBL RBL: Relay in RNBL,

https://senderscore.org/blacklistlookup/

[149.72.70.187 listed in bl.score.senderscore.com]

1.6 RCVD_IN_MSPIKE_L3 RBL: Low reputation (-3)

[149.72.70.187 listed in bl.mailspike.net]

-0.0 SPF_PASS SPF: sender matches SPF record

0.0 RCVD_IN_MSPIKE_BL Mailspike blacklisted

15 GR_DOMAIN_SENDGR1 Received contains spammer id (sendgr)

0.8 ZMIvirSobY_SUB39 SPAM from Sober-Y-Virus

0.6 J_CHICKENPOX_64 BODY: 6alpha-pock-4alpha

0.6 J_CHICKENPOX_63 BODY: 6alpha-pock-3alpha

0.6 J_CHICKENPOX_37 BODY: 3alpha-pock-7alpha

1.5 MR_STRANGE_QUESTION URI: No description available.

0.0 HTML_MESSAGE BODY: HTML included in message

0.0 HTML_FONT_SIZE_HUGE BODY: HTML font size is huge

0.0 T_DKIM_INVALID DKIM-Signature header exists but is not valid

0.8 SARE_FROM_SPAM_WORD3 I don't know people named this!

1.0 ACCT_PHISHING Possible phishing for account information

1.0 XPRIO Has X-Priority header

0.9 URI_PHISH Phishing using web form

Subject: {SPAM?} Action Needed: Review Your Brokerage Account Information



This is a multi-part message in MIME format.



--324106537a241c5ea8379fdd000f1111

Content-Type: text/plain; charset=iso-8859-1

Content-Transfer-Encoding: quoted-printable



Action Needed: Review Your Brokerage Account Information MESSAGE CONFIRMAT=

ION Action Needed: Review Your Brokerage Account InformationDear Client,You=

r brokerage account currently requires an account information review.Keepin=

g your account details accurate and up to date is important for the ongoing=

use of your brokerage account and related services. Please verify the info=

rmation registered to your account and make any necessary updates where app=

licable.To complete this account task, please use the secure review page pr=

ovided below: Complete Update.Once the requested information has been submi=

tted, the account update will be processed and reflected in your brokerage =

profile. You will receive notification when the review has been completed.I=

f the required update remains outstanding, certain account functions may be=

affected. This may include temporary limitations on trading, transactions,=

account services, or other available features.If you have any questions re=

garding this request, please reach customer assistance through the official=

support channel. Stay connectedTerms of use|Privacy policy|ABC's of securi=

ty=A9 National Bank of Canada. All rights reserved. Any reproduction, in wh=

ole or in part, is strictly prohibited without the prior written consent of=

National Bank of Canada. National Bank of Canada, 800 St-Jacques Street, M=

ontreal (Quebec)H3C 1A3nbc.caFor options to unsubscribe, click here. CONFID=

ENTIALIT=C9 : Ce document est destin=E9 uniquement =E0 la personne ou =E0 l=

'entit=E9 =E0 qui il est adress=E9. L'information apparaissant dans ce docu=

ment est de nature l=E9galement privil=E9gi=E9e et confidentielle. Si vous =

n'=EAtes pas le destinataire vis=E9 ou la personne charg=E9e de le remettre=

=E0 son destinataire, vous =EAtes, par la pr=E9sente, avis=E9 que toute le=

cture, usage, copie ou communication du contenu de ce document est strictem=

ent interdit. De plus, vous =EAtes pri=E9 de communiquer avec l'exp=E9diteu=

r sans d=E9lai et de d=E9truire ce document imm=E9diatement. CONFIDENTIALIT=

Y: This document is intended solely for the individual or entity to whom it=

is addressed. The information contained in this document is legally privil=

eged and confidential. If you are not the intended recipient or the person =

responsible for delivering it to the intended recipient, you are hereby adv=

ised that you are strictly prohibited from reading, using, copying or disse=

minating the contents of this document. Please inform the sender immediatel=

y and delete this document immediately.=20=



--324106537a241c5ea8379fdd000f1111

Content-Type: text/html; charset=iso-8859-1

Content-Transfer-Encoding: quoted-printable





Action Needed: Review Your Brokerage Account Information=<br /><br />








0>






style=3D"FONT-SIZE: 11px; FONT-FAMILY: Arial,sans-serif,'Open Sans'; CO=

LOR: #666666; PADDING-BOTTOM: 45px; LINE-HEIGHT: 12px"=20

vAlign=3Dtop width=3D600 align=3Dleft>
style=3D"TEXT-DECORATION: underline; COLOR: #666666"=20

href=3D"https://z7f2p6w1j9t4g8b3mx.live" target=3D_blank>
style=3D"DISPLAY: block" border=3D0 alt=3D"Button to the BNC website"=

=20

src=3D"https://www.bnc.ca/content/dam/bnc/formulaires/picto/NB_2D_RGB=

.jpg"=20

width=3D217>



der=3D0>




DY>


E>


der=3D0>






align=3Dcenter>
gn=3Dcenter=20

border=3D0>






style=3D"FONT-SIZE: 14px; FONT-FAMILY: Arial,sans-serif,'Open San=

s'; COLOR: #333333; LINE-HEIGHT: 19px"=20

vAlign=3Dtop width=3D600 align=3Dleft>


0>








align=3Dleft>3D""=20<br
src=3D"https://www.bnc.ca/content/dam/bnc/formulaires/mod=

ele-courriel/icon-confirm-84x44.gif"=20

width=3D42 height=3D22>



style=3D"FONT-SIZE: 14px; FONT-FAMILY: Arial,sans-serif; =

FONT-WEIGHT: bold; COLOR: #ffffff; PADDING-BOTTOM: 0px; PADDING-TOP: 0px; P=

ADDING-LEFT: 0px; MARGIN: 0px; LINE-HEIGHT: 19px; PADDING-RIGHT: 0px">MESSA=

GE=20

CONFIRMATION=20


Y>


der=3D0>








der=3D0>






style=3D"FONT-SIZE: 14px; FONT-FAMILY: Arial,sans-serif,'Open San=

s'; COLOR: #333333; LINE-HEIGHT: 19px"=20

vAlign=3Dtop align=3Dleft>


style=3D"FONT-SIZE: 20px; FONT-FAMILY: Arial,sans-serif; FONT-W=

EIGHT: normal; COLOR: #00334d; PADDING-BOTTOM: 0px; PADDING-TOP: 0px; PADDI=

NG-LEFT: 0px; MARGIN: 0px; LINE-HEIGHT: 24px; PADDING-RIGHT: 0px">Action=20

Needed: Review Your Brokerage Account Information


style=3D"FONT-SIZE: 10px; HEIGHT: 10px; LINE-HEIGHT: 10px">
V>Dear=20

Client,

Your brokerage account currently requires an acc=

ount=20

information review.

Keeping your account details accurat=

e and=20

up to date is important for the ongoing use of your brokerage=20

account and related services. Please verify the information=20

registered to your account and make any necessary updates where=

=20

applicable.

To complete this account task, please use th=

e=20

secure review page provided below:
href=3D"https://z7f2p6w1j9t4g8b3mx.live">Complete=20

Update.

Once the requested information has been=20

submitted, the account update will be processed and reflected i=

n=20

your brokerage profile. You will receive notification when the=20

review has been completed.

If the required update remain=

s=20

outstanding, certain account functions may be affected. This ma=

y=20

include temporary limitations on trading, transactions, account=

=20

services, or other available features.

If you have any=20

questions regarding this request, please reach customer assista=

nce=20

through the official support channel.=20




der=3D0>






align=3Dcenter>
der=3D0>




der=3D0>






style=3D"BORDER-TOP: #a6a6a6 1px solid; BORDER-BOTTOM: #a6a6a6 1px soli=

d; PADDING-BOTTOM: 12px; PADDING-TOP: 12px"=20

vAlign=3Dtop align=3Dcenter>








R>






er=20

border=3D0>




>
style=3D"WIDTH: 630px; MIN-WIDTH: 630px; MIN-HEIGHT: 1px;=

DISPLAY: block; MAX-HEIGHT: 1px"=20

alt=3D""=20

src=3D"https://www.bnc.ca/content/dam/bnc/formulaires/mod=

ele-courriel/spacer-social-media-1x1.gif"=20

width=3D630 height=3D1>



er=20

border=3D0>








ABLE>



=3Dcenter=20

border=3D0>






height=3D1>
style=3D"WIDTH: 600px; MIN-WIDTH: 600px; MIN-HEIGHT=

: 1px; DISPLAY: block; MAX-HEIGHT: 1px"=20

alt=3D""=20

src=3D"https://www.bnc.ca/content/dam/bnc/formulair=

es/modele-courriel/spacer-social-media-1x1.gif"=20

width=3D600 height=3D1>

TD>



er=3D0>






style=3D"FONT-SIZE: 11px; FONT-FAMILY: Arial,sans-ser=

if,'Open Sans'; COLOR: #000000; LINE-HEIGHT: 15px; PADDING-RIGHT: 4px"=20

vAlign=3Dmiddle align=3Dright>Stay connected


style=3D"FONT-SIZE: 11px; FONT-FAMILY: Arial,sans-ser=

if,'Open Sans'; COLOR: #000000; PADDING-LEFT: 6px; LINE-HEIGHT: 15px"=20

vAlign=3Dmiddle width=3D25 align=3Dleft>
href=3D"https://www.facebook.com/nationalbanknetwor=

ks"=20

target=3D_blank>3D""=20<br
src=3D"https://www.bnc.ca/content/dam/bnc/formulair=

es/modele-courriel/icon-facebook-25x25.gif"=20

width=3D25 height=3D25>


style=3D"FONT-SIZE: 11px; FONT-FAMILY: Arial,sans-ser=

if,'Open Sans'; COLOR: #000000; PADDING-LEFT: 6px; LINE-HEIGHT: 15px"=20

vAlign=3Dmiddle width=3D25 align=3Dleft>
href=3D"https://twitter.com/nationalbank/"=20

target=3D_blank>3D""=20<br
src=3D"https://www.bnc.ca/content/dam/bnc/formulair=

es/modele-courriel/icon-twitter-25x25.gif"=20

width=3D25 height=3D25>


style=3D"FONT-SIZE: 11px; FONT-FAMILY: Arial,sans-ser=

if,'Open Sans'; COLOR: #000000; PADDING-LEFT: 6px; LINE-HEIGHT: 15px"=20

vAlign=3Dmiddle width=3D25 align=3Dleft>
href=3D"https://www.youtube.com/user/nationalbankne=

tworks"=20

target=3D_blank>3D""=20<br
src=3D"https://www.bnc.ca/content/dam/bnc/formulair=

es/modele-courriel/icon-youtube-25x25.gif"=20

width=3D25 height=3D25>


style=3D"FONT-SIZE: 11px; FONT-FAMILY: Arial,sans-ser=

if,'Open Sans'; COLOR: #000000; PADDING-LEFT: 6px; LINE-HEIGHT: 15px"=20

vAlign=3Dmiddle width=3D25 align=3Dleft>
href=3D"https://www.linkedin.com/company/national-b=

ank-of-canada/"=20

target=3D_blank>3D""=20<br
src=3D"https://www.bnc.ca/content/dam/bnc/formulair=

es/modele-courriel/icon-linkedin-25x25.gif"=20

width=3D25=20

height=3D25>



der=3D0>








der=3D0>






style=3D"FONT-SIZE: 11px; FONT-FAMILY: Arial,sans-serif,'Open San=

s'; COLOR: #686868; PADDING-BOTTOM: 30px; PADDING-TOP: 30px; LINE-HEIGHT: 1=

5px"=20

vAlign=3Dtop align=3Dleft>








style=3D"FONT-SIZE: 11px; FONT-FAMILY: Arial,sans-serif,'Op=

en Sans'; COLOR: #686868; PADDING-BOTTOM: 15px; LINE-HEIGHT: 15px"=20

vAlign=3Dmiddle align=3Dleft>
style=3D"TEXT-DECORATION: underline; COLOR: #686868"=20

href=3D"https://www.nbc.ca/terms-of-use.html?utm_campaign=

=3Dacq_credit-card_aem-forms-email_en&utm_medium=3Demail&utm_source=

=3Depush-bnc&utm_content=3Dinterrompu&utm_term=3D"=20

target=3D_blank>Terms of=20

use



style=3D"FONT-SIZE: 11px; FONT-FAMILY: Arial,sans-serif,'Op=

en Sans'; COLOR: #686868; PADDING-BOTTOM: 15px; LINE-HEIGHT: 15px"=20

vAlign=3Dmiddle width=3D20 align=3Dcenter>|


style=3D"FONT-SIZE: 11px; FONT-FAMILY: Arial,sans-serif,'Op=

en Sans'; COLOR: #686868; PADDING-BOTTOM: 15px; LINE-HEIGHT: 15px"=20

vAlign=3Dmiddle align=3Dleft>
style=3D"TEXT-DECORATION: underline; COLOR: #686868"=20

href=3D"https://www.nbc.ca/privacy-policy.html?utm_campai=

gn=3Dacq_credit-card_aem-forms-email_en&utm_medium=3Demail&utm_sour=

ce=3Depush-bnc&utm_content=3Dinterrompu&utm_term=3D"=20

target=3D_blank>Privacy=20

policy



style=3D"FONT-SIZE: 11px; FONT-FAMILY: Arial,sans-serif,'Op=

en Sans'; COLOR: #686868; PADDING-BOTTOM: 15px; LINE-HEIGHT: 15px"=20

vAlign=3Dmiddle width=3D20 align=3Dcenter>|


style=3D"FONT-SIZE: 11px; FONT-FAMILY: Arial,sans-serif,'Op=

en Sans'; COLOR: #686868; PADDING-BOTTOM: 15px; LINE-HEIGHT: 15px"=20

vAlign=3Dmiddle align=3Dleft>
style=3D"TEXT-DECORATION: underline; COLOR: #686868"=20

href=3D"https://www.nbc.ca/abcs-of-security.html?utm_camp=

aign=3Dacq_credit-card_aem-forms-email_en&utm_medium=3Demail&utm_so=

urce=3Depush-bnc&utm_content=3Dinterrompu&utm_term=3D"=20

target=3D_blank>ABC's of=20

security



style=3D"FONT-SIZE: 15px; HEIGHT: 15px; LINE-HEIGHT: 15px">
V>
style=3D"FONT-SIZE: 8px; VERTICAL-ALIGN: 5px; LINE-HEIGHT: 0">=

=A9=20

National Ba=

nk of=20

Canada. All rights reserved. Any reproduction, in whole or in p=

art,=20

is strictly prohibited without the prior written consent of
AN=20

style=3D"WHITE-SPACE: nowrap">National Bank of Cana=

da.=20



National Bank of Canada, 800 St-Jacques Street,=20

Montreal (Quebec)  
style=3D"WHITE-SPACE: nowrap">H3C 1A3


>
style=3D"TEXT-DECORATION: underline; COLOR: #686868"=20

href=3D"https://www.nbc.ca?utm_campaign=3Dacq_credit-card_aem-f=

orms-email_en&utm_medium=3Demail&utm_source=3Depush-bnc&utm_con=

tent=3Dconfirmation&utm_term=3D"=20

target=3D_blank>
style=3D"COLOR: #686868">nbc.ca

For options t=

o=20

unsubscribe,
6868"=20

href=3D"https://www.nbc.ca/forms/communications/withdraw-consen=

t.html"=20

target=3D_blank>click here
>
.=20


DY>


style=3D"FONT-SIZE: 8pt; FONT-FAMILY: 'Cambria','times roman',serif; LINE-H=

EIGHT: 10pt">
CONFIDENTIALIT=C9=20

: Ce document est destin=E9 uniquement =E0 la personne ou =E0 l'entit=E9 =

=E0 qui il est=20

adress=E9. L'information apparaissant dans ce document est de nature l=E9ga=

lement=20

privil=E9gi=E9e et confidentielle. Si vous n'=EAtes pas le destinataire vis=

=E9 ou la=20

personne charg=E9e de le remettre =E0 son destinataire, vous =EAtes, par la=

pr=E9sente,=20

avis=E9 que toute lecture, usage, copie ou communication du contenu de ce d=

ocument=20

est strictement interdit. De plus, vous =EAtes pri=E9 de communiquer avec=20

l'exp=E9diteur sans d=E9lai et de d=E9truire ce document imm=E9diatement.=20


CONFIDENTIALITY: This document is intended solely for the individual or=

=20

entity to whom it is addressed. The information contained in this document =

is=20

legally privileged and confidential. If you are not the intended recipient =

or=20

the person responsible for delivering it to the intended recipient, you are=

=20

hereby advised that you are strictly prohibited from reading, using, copyin=

g or=20

disseminating the contents of this document. Please inform the sender=20

immediately and delete this document immediately.












--324106537a241c5ea8379fdd000f1111--



National Bank phish from Sendgrid

X-Mozilla-Status: 0001

X-Mozilla-Status2: 00000000

Return-path:

Envelope-to: dave@doctor.nl2k.ab.ca

Delivery-date: Thu, 20 Aug 2026 10:15:00 -0600

Received: from doctor by doctor.nl2k.ab.ca with local (Exim 4.99.5 (FreeBSD))

(envelope-from )

id 1wx5Pl-00000000MGE-1aMn

for dave@doctor.nl2k.ab.ca;

Thu, 20 Aug 2026 10:14:49 -0600

Resent-From: The Doctor

Resent-Date: Thu, 20 Aug 2026 10:14:49 -0600

Resent-Message-ID:

Resent-To: Dave Yadallee

Received: from s.wrqvqsbb.outbound-mail.sendgrid.net ([149.72.70.187]:64524)

by doctor.nl2k.ab.ca with esmtps (TLS1.3) tls TLS_AES_128_GCM_SHA256

(Exim 4.99.5 (FreeBSD))

(envelope-from )

id 1wx3NO-00000000KEg-2u1Q

for doctor@doctor.nl2k.ab.ca;

Thu, 20 Aug 2026 08:04:22 -0600

DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=gywqi.com;

h=from:subject:date:mime-version:to:content-type:cc:content-type:date:

from:subject:to;

s=s1; t=1787234601;

bh=QBVHvZOShbdi6GlXsez1BA1vShnsgOHrPTP63nvohYQ=;

b=Uu0tEL7FgnXqQxWQerAPbfHyhOcF17tv2sh9HRzg4wlvy5HPILaOLzJXfi1C5v4gVw0H

Zxxd8INw2YB5/bOBj3XQydcwlL5VC83QC6SExtszuCA7sKQ5XUGZwD5p/uztRfxC1EYtY9

RQEiHdqMBTodvnGNoxvN/oa6/NfGYRzCzvurwooM9ytkh2g+7j8ahRSW/sgZgSPR7xKLhz

aYnQ47l81stYwhLQALhRZvvGZeErIk3jdxVw8m7lNxtVZK1CIgHOql/C0WsVvzwWYq7fio

YDY+rNX4Cmtj3MJf6iMGOIbBrfGQPiLhsWmYvUrye80q8rTD4NNsOHQHB+CgTqmA==

Received: by recvd-75c96bbb78-t4k4l with SMTP id recvd-75c96bbb78-t4k4l-1-6A870929-4C

2026-08-20 14:03:21.216668013 +0000 UTC m=+1969865.210055325

Received: from dryuptechnology.com (unknown)

by geopod-ismtpd-0 (SG)

with ESMTP id iXExYestTmSRWSl12iCejg

for ;

Thu, 20 Aug 2026 14:03:20.984 +0000 (UTC)

Message-Id: <0cd6cfcbaf98b2374f72db9c35d91643@gywqi.com>

From: National Bank Direct Brokerage-Secure <1OE8I9@gywqi.com>

Subject: Important Brokerage Account Information Update

Date: Thu, 20 Aug 2026 14:03:21 +0000 (UTC)

X-Priority: 3

X-Mailer: Goryt Tajqxxurhgf Vwhranqywqqc 169

Mime-Version: 1.0

X-SG-EID:

=?us-ascii?Q?u001=2EqSrTYuf+buIuYTIRkkJ60PaCuK8FLEKUxWjcziMBe28GJ21d6ci3ZY1E8?=

=?us-ascii?Q?jMGVY5cm83vgvA+Us9Q9w7ImkWPdFJQRfgud8le?=

=?us-ascii?Q?HERqSzGMb8CXcQaFblygry59Epzlazh0I0GZWV0?=

=?us-ascii?Q?gknoE4AuTzKds6hvLI9ROMACj1sxheBdTFe=2FOKQ?=

=?us-ascii?Q?TufnOsQYeQlzdaWrNe2aiH4XKsvHm5u2Sljbz4c?=

=?us-ascii?Q?2XL2PIW+QOGPizLF18r46ozxY4G55nNnVMzoV4K?=

=?us-ascii?Q?2wP3yZifh9jxSlfvGhZs6+w8uA=3D=3D?=

To: doctor

X-Entity-ID: u001.hwz/4ON2U4jEhsV5As9sWA==

Content-Type: multipart/alternative;

boundary="9e752fd94d989cc6f97d599900011641"

X-Spam_score: 34.7

X-Spam_score_int: 347

X-Spam_bar: ++++++++++++++++++++++++++++++++++

X-Spam_report: Spam detection software, running on the system "doctor.nl2k.ab.ca",

has identified this incoming email as possible spam. The original

message has been attached to this so you can view it or label

similar future email. If you have any questions, see

@@CONTACT_ADDRESS@@ for details.



Content preview: Important Brokerage Account Information Update MESSAGE CONFIRMATION

Important Brokerage Account Information UpdateDear Client,This message is

regarding a pending account maintenance requirement for yo [...]



Content analysis details: (34.7 points, 5.0 required)



pts rule name description

---- ---------------------- --------------------------------------------------

1.0 RCVD_IN_WSFF RBL: Received via a relay in will-spam-for-food.eu.org

[149.72.70.187 listed in will-spam-for-food.eu.org]

[149.72.70.187 listed in will-spam-for-food.eu.org]

[149.72.70.187 listed in will-spam-for-food.eu.org]

[149.72.70.187 listed in will-spam-for-food.eu.org]

[149.72.70.187 listed in will-spam-for-food.eu.org]

[149.72.70.187 listed in will-spam-for-food.eu.org]

[149.72.70.187 listed in will-spam-for-food.eu.org]

[149.72.70.187 listed in will-spam-for-food.eu.org]

1.6 RCVD_IN_MSPIKE_L3 RBL: Low reputation (-3)

[149.72.70.187 listed in bl.mailspike.net]

1.5 RCVD_IN_AHBL RBL: AHBL: sender is listed in dnsbl.ahbl.org

[149.72.70.187 listed in dnsbl.ahbl.org]

[149.72.70.187 listed in dnsbl.ahbl.org]

[149.72.70.187 listed in dnsbl.ahbl.org]

[149.72.70.187 listed in dnsbl.ahbl.org]

0.0 RCVD_IN_AHBL_RTB RBL: AHBL: Real-Time Blocked in dnsbl.ahbl.org

[149.72.70.187 listed in dnsbl.ahbl.org]

0.5 RCVD_IN_AHBL_SMTP RBL: AHBL: Open SMTP relay in dnsbl.ahbl.org

[149.72.70.187 listed in dnsbl.ahbl.org]

0.5 RCVD_IN_AHBL_PROXY RBL: AHBL: Open Proxy server in dnsbl.ahbl.org

[149.72.70.187 listed in dnsbl.ahbl.org]

1.5 RCVD_IN_AHBL_SPAM RBL: AHBL: Spam Source in dnsbl.ahbl.org

[149.72.70.187 listed in dnsbl.ahbl.org]

2.5 URIBL_DBL_SPAM Contains a spam URL listed in the DBL blocklist

[URI: gywqi.com]

-3.0 RCVD_IN_RP_CERTIFIED RBL: Sender in ReturnPath Certified - Contact

cert-sa@returnpath.net

[Excessive Number of Queries | ]

-2.0 RCVD_IN_RP_SAFE RBL: Sender in ReturnPath Safe - Contact

safe-sa@returnpath.net

[Excessive Number of Queries | ]

1.3 RCVD_IN_RP_RNBL RBL: Relay in RNBL,

https://senderscore.org/blacklistlookup/

[149.72.70.187 listed in bl.score.senderscore.com]

-0.0 SPF_PASS SPF: sender matches SPF record

0.0 RCVD_IN_MSPIKE_BL Mailspike blacklisted

15 GR_DOMAIN_SENDGR1 Received contains spammer id (sendgr)

0.8 ZMIvirSobY_SUB39 SPAM from Sober-Y-Virus

2.0 TVD_PH_REC BODY: Message includes a phrase commonly used in phishing

mails

0.6 J_CHICKENPOX_64 BODY: 6alpha-pock-4alpha

0.6 J_CHICKENPOX_63 BODY: 6alpha-pock-3alpha

0.6 J_CHICKENPOX_37 BODY: 3alpha-pock-7alpha

1.5 MR_STRANGE_QUESTION URI: No description available.

0.0 HTML_MESSAGE BODY: HTML included in message

0.0 HTML_FONT_SIZE_HUGE BODY: HTML font size is huge

0.0 T_DKIM_INVALID DKIM-Signature header exists but is not valid

2.5 XM_RANDOM X-Mailer apparently random

2.0 MIXED_HREF_CASE Has href in mixed case

0.8 SARE_FROM_SPAM_WORD3 I don't know people named this!

1.0 ACCT_PHISHING Possible phishing for account information

1.0 XPRIO Has X-Priority header

0.9 URI_PHISH Phishing using web form

Subject: {SPAM?} Important Brokerage Account Information Update







Button to the BNC website



MESSAGE CONFIRMATION

Important Brokerage Account Information Update

Dear Client,



This message is regarding a pending account maintenance requirement for your brokerage account.



As part of maintaining current and accurate account records, you are required to review and update your account information. Keeping these details current helps ensure that your brokerage account remains available for normal use and that applicable account services can continue without interruption.



Please complete the required account information update through the secure page below: Complete Update.



Following submission, the updated information will be processed and applied to your account record. A confirmation will be provided after the account task has been successfully finalized.



Until the required update is completed, access to certain account services or functions may be subject to temporary restrictions. This may include trading activity, transaction processing, or other brokerage account features.



For further assistance, please contact the official customer support team.

Stay connected

Terms of use | Privacy policy | ABC's of security

© National Bank of Canada. All rights reserved. Any reproduction, in whole or in part, is strictly prohibited without the prior written consent of National Bank of Canada.



National Bank of Canada, 800 St-Jacques Street, Montreal (Quebec) H3C 1A3



nbc.ca



For options to unsubscribe, click here.





CONFIDENTIALITÉ : Ce document est destiné uniquement à la personne ou à l'entité à qui il est adressé. L'information apparaissant dans ce document est de nature légalement privilégiée et confidentielle. Si vous n'êtes pas le destinataire visé ou la personne chargée de le remettre à son destinataire, vous êtes, par la présente, avisé que toute lecture, usage, copie ou communication du contenu de ce document est strictement interdit. De plus, vous êtes prié de communiquer avec l'expéditeur sans délai et de détruire ce document immédiatement.

CONFIDENTIALITY: This document is intended solely for the individual or entity to whom it is addressed. The information contained in this document is legally privileged and confidential. If you are not the intended recipient or the person responsible for delivering it to the intended recipient, you are hereby advised that you are strictly prohibited from reading, using, copying or disseminating the contents of this document. Please inform the sender immediately and delete this document immediately.



Business Broker spam from Google Gmail

X-Mozilla-Status: 0001

X-Mozilla-Status2: 00000000

Return-path:

Envelope-to: dave@doctor.nl2k.ab.ca

Delivery-date: Thu, 20 Aug 2026 10:15:00 -0600

Received: from doctor by doctor.nl2k.ab.ca with local (Exim 4.99.5 (FreeBSD))

(envelope-from )

id 1wx5Pg-00000000MFN-0djH

for dave@doctor.nl2k.ab.ca;

Thu, 20 Aug 2026 10:14:44 -0600

Resent-From: The Doctor

Resent-Date: Thu, 20 Aug 2026 10:14:44 -0600

Resent-Message-ID:

Resent-To: Dave Yadallee

Received: from mail-yw1-f169.google.com ([209.85.128.169]:44068)

by doctor.nl2k.ab.ca with esmtps (TLS1.3) tls TLS_AES_128_GCM_SHA256

(Exim 4.99.5 (FreeBSD))

(envelope-from )

id 1wx3MZ-00000000K07-2Qyc

for sales@nk.ca;

Thu, 20 Aug 2026 08:03:36 -0600

Received: by mail-yw1-f169.google.com with SMTP id 00721157ae682-836c8bdac50so33628147b3.0

for ; Thu, 20 Aug 2026 07:02:36 -0700 (PDT)

DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed;

d=bankingtheadvisoryib.com; s=google; t=1787234550; x=1787839350; darn=nk.ca;

h=content-type:mime-version:date:content-transfer-encoding:subject:to

:from:references:in-reply-to:message-id:from:to:cc:subject:date

:message-id:reply-to:content-type;

bh=i4QjuTNwKZMpL6gC+niWZZl8b2eB0SemAUcaNX/Wa3w=;

b=fJf6rn8rGFpUgCF4L8nT3N7M1DxbBqzUN+yiBXoBrxne1u6sTsQffCeZEcNi0u+D2q

hObvJijh41IIrliBGR9eUOZTElp2MriUGsKVAmhrM7URLULWbQAynDGpWy2FKcfm2wdC

vP5IXaJoqOWH2Y3P6WX7Id/aw1VoBj8Nt0HiHqNheiatpVde2UIlbihI9jWLMPTaqCqL

V4YJJLNr1cpH6lMbLYTyBN6tIAITvmTONdtk45fY0Qw1D8YHHLA41J+W4R5sycSggPOq

f/R3juyTFNVCoFNJ1QMKNVmx97YIjrzTLUKa46AyxKxCf4avNwNl7SlulpHTe1pBlxbD

z1xQ==

X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed;

d=1e100.net; s=20251104; t=1787234550; x=1787839350;

h=content-type:mime-version:date:content-transfer-encoding:subject:to

:from:references:in-reply-to:message-id:x-gm-gg:x-gm-message-state

:from:to:cc:subject:date:message-id:reply-to:content-type;

bh=i4QjuTNwKZMpL6gC+niWZZl8b2eB0SemAUcaNX/Wa3w=;

b=FgZAsbFMmm2ZFsd91s5jXZPD73UTXeTLU5l+JN50+0hqhxOjnTm2qXSrYs6nZ9oz3R

J0mMH2X8SvjCibq5en8TLjXdnEVg+yjAM6Smp6U5+rtY9RK9ceiSD51sO4akcB3rm49N

O0iUtfLY2bvVzmRWEZcPFHN7s8mPoZs5bGggBfgA7ALqOdByMF9St62xRZ7TeH6JsUBC

8ZgfyshF1DQgg7b1toUlVzZT3YJB9aJWQqA6pdtt2WbL3bSYa2w8V6wKnqyB8c5NTH6m

khK3Nz6KTpiaaASH9tW2U53U38P0vhzwq+oAkr+uulGzHE/ZS7RV7XbSK+Ww38MEZ8EL

h+UQ==

X-Gm-Message-State: AFuF++le6LUF7pQ094w9aKGPvZj65mRiP+A230F844jNEWL7HkK8ay38

Rag6OuUkGUyGSEucxUEHyLq60VJbMfvc2iVyKJo/KuaGxig1yhwg7Vv+pmGKQT7KynXMn1aB1LW

2MIBNYA==

X-Gm-Gg: AR+sD10lJq+v3Ns6eJRJwAvhS8roOPru59Cf9WX03NDrKieZ7ydr6sN60A2WY138CBA

TnKX8o0nlVsc3Z92mBP2feYbJaWZTJ7GISfRZaQLfASqDTN8fEJuoRszvmeauDIhLWpFjmTxPF5

3dgLT4Cn8ONN3WbIYJS+BEQEyGfDcG2PPzQO33sL1K7fVE/uPiPAeAyXAw+7kHsNSxVq8Im01bL

Sev7LIh+oix8jE+42wD0Mddk4G8beuk22j/gqLeBIWmYBbko5i3JhMt0XPxFEQNM2E6KH4iHVqa

Uk4hBaL/xwUXx5L8ZYfFfrwx4M9QLfY0TsBEUoLG/rz+YOKUNJ7uHiwcWJTS4XzCaUojAa4iKgY

lWMSXuiv0OvXJrDLTdMvZEPEVxQHqZrPFndftT6PKZSQHNV5L8XN8EWR7hdyfrIhRRiG6OD2CYP

qnpQtpB/AHtf2153WL5YMjfNc+kzY8Xoo48b14jK8u2/AE6WQuZ3Y03Jl4c+f8jCFQ4b1M7nwQw

7i+c36yy+5r/PlpFsLgQwmRwcerYtGr1HQqCYnLp80crP2i3N0jsVM3tDp0Stnj57YH+bthPBGX

1NDB6SssccBBtrmdxP2YiT7Acw==

X-Received: by 2002:a05:690c:397:b0:847:8ef9:fa30 with SMTP id 00721157ae682-8478f093db2mr19746907b3.13.1787234548583;

Thu, 20 Aug 2026 07:02:28 -0700 (PDT)

Received: from 01a01f7a-f363-7221-a099-00339bcf7bb6.local (ec2-35-168-20-52.compute-1.amazonaws.com. [35.168.20.52])

by smtp.gmail.com with ESMTPSA id 00721157ae682-84512664915sm24128107b3.13.2026.08.20.07.02.27

for

(version=TLS1_3 cipher=TLS_AES_256_GCM_SHA384 bits=256/256);

Thu, 20 Aug 2026 07:02:27 -0700 (PDT)

Message-ID: <01a01f7a-f363-7221-a099-00339bcf7bb6@bankingtheadvisoryib.com>

In-Reply-To:

<01a0100e-b9f5-703d-8d3b-111f37b9c027@bankingtheadvisoryib.com>

References: <01a0100e-b9f5-703d-8d3b-111f37b9c027@bankingtheadvisoryib.com>

X-Mail-Abuse-Inquiries:

https://app.instantly.ai/privacy/report-abuse/01a01f7a-f363-7221-a099-00339bcf7bb6

From: Oliver Bogner

To: sales@nk.ca

Subject: Re: Buyer for Netknow Internet Knowledge

Content-Transfer-Encoding: quoted-printable

Date: Thu, 20 Aug 2026 14:02:26 +0000

MIME-Version: 1.0

Content-Type: text/plain; charset=utf-8

X-Spam_score: 7.0

X-Spam_score_int: 70

X-Spam_bar: +++++++

X-Spam_report: Spam detection software, running on the system "doctor.nl2k.ab.ca",

has identified this incoming email as possible spam. The original

message has been attached to this so you can view it or label

similar future email. If you have any questions, see

@@CONTACT_ADDRESS@@ for details.



Content preview: Free on Tuesday? Oliver Bogner Managing Partner | The Advisory

Investment Bank Q1 2026 #1 Lower Middle Market Investment Bank on Axial 5x

Top 5 Lower Middle Market Investment Bank on Axial 2x Forbes 30 Under 30

Alumni [...]



Content analysis details: (7.0 points, 5.0 required)



pts rule name description

---- ---------------------- --------------------------------------------------

1.0 RCVD_IN_WSFF RBL: Received via a relay in will-spam-for-food.eu.org

[35.168.20.52 listed in will-spam-for-food.eu.org]

[35.168.20.52 listed in will-spam-for-food.eu.org]

[35.168.20.52 listed in will-spam-for-food.eu.org]

[35.168.20.52 listed in will-spam-for-food.eu.org]

[35.168.20.52 listed in will-spam-for-food.eu.org]

[35.168.20.52 listed in will-spam-for-food.eu.org]

[35.168.20.52 listed in will-spam-for-food.eu.org]

[35.168.20.52 listed in will-spam-for-food.eu.org]

[209.85.128.169 listed in will-spam-for-food.eu.org]

[209.85.128.169 listed in will-spam-for-food.eu.org]

[209.85.128.169 listed in will-spam-for-food.eu.org]

[209.85.128.169 listed in will-spam-for-food.eu.org]

[209.85.128.169 listed in will-spam-for-food.eu.org]

[209.85.128.169 listed in will-spam-for-food.eu.org]

[209.85.128.169 listed in will-spam-for-food.eu.org]

[209.85.128.169 listed in will-spam-for-food.eu.org]

1.5 RCVD_IN_AHBL RBL: AHBL: sender is listed in dnsbl.ahbl.org

[209.85.128.169 listed in dnsbl.ahbl.org]

[209.85.128.169 listed in dnsbl.ahbl.org]

[209.85.128.169 listed in dnsbl.ahbl.org]

[209.85.128.169 listed in dnsbl.ahbl.org]

[35.168.20.52 listed in dnsbl.ahbl.org]

[35.168.20.52 listed in dnsbl.ahbl.org]

[35.168.20.52 listed in dnsbl.ahbl.org]

[35.168.20.52 listed in dnsbl.ahbl.org]

1.5 RCVD_IN_AHBL_SPAM RBL: AHBL: Spam Source in dnsbl.ahbl.org

[209.85.128.169 listed in dnsbl.ahbl.org]

0.0 RCVD_IN_AHBL_RTB RBL: AHBL: Real-Time Blocked in dnsbl.ahbl.org

[209.85.128.169 listed in dnsbl.ahbl.org]

0.5 RCVD_IN_AHBL_SMTP RBL: AHBL: Open SMTP relay in dnsbl.ahbl.org

[209.85.128.169 listed in dnsbl.ahbl.org]

0.5 RCVD_IN_AHBL_PROXY RBL: AHBL: Open Proxy server in dnsbl.ahbl.org

[209.85.128.169 listed in dnsbl.ahbl.org]

-2.0 RCVD_IN_RP_SAFE RBL: Sender in ReturnPath Safe - Contact

safe-sa@returnpath.net

[Excessive Number of Queries | ]

-3.0 RCVD_IN_RP_CERTIFIED RBL: Sender in ReturnPath Certified - Contact

cert-sa@returnpath.net

[Excessive Number of Queries | ]

-0.0 SPF_PASS SPF: sender matches SPF record

1.9 URIBL_ABUSE_SURBL Contains an URL listed in the ABUSE SURBL blocklist

[URI: bankingtheadvisoryib.com]

1.9 URIBL_JP_SURBL Contains an URL listed in the JP SURBL blocklist

[URI: bankingtheadvisoryib.com]

1.3 RCVD_IN_RP_RNBL RBL: Relay in RNBL,

https://senderscore.org/blacklistlookup/

[209.85.128.169 listed in bl.score.senderscore.com]

-0.0 RCVD_IN_DNSWL_NONE RBL: Sender listed at http://www.dnswl.org/, no

trust

[209.85.128.169 listed in list.dnswl.org]

-0.2 RCVD_IN_MSPIKE_H2 RBL: Average reputation (+2)

[209.85.128.169 listed in wl.mailspike.net]

2.0 RATWR8_MESSID Message-ID with excessive dashes and dollars

0.0 T_DKIM_INVALID DKIM-Signature header exists but is not valid

Subject: {SPAM?} Re: Buyer for Netknow Internet Knowledge



Free on Tuesday?



Oliver Bogner

Managing Partner | The Advisory Investment =

Bank

Q1 2026 #1 Lower Middle Market Investment Bank on Axial

5x Top 5 Lower Middle Market Investment Bank on Axial

2x Forbes 30 Under 30 Alumni | 2x Inc 5,000 CEO



On Mon, August 17, 2026 =

2:09 PM, Oliver Bogner

[ceo@bankingtheadvisoryib.com]> wrote:



> Hey,

>=20

> We're the number 1-ranked lower middle market investment bank in the US =

(Axial, 2026) and there's a buyer who reached out specifically regarding =

Netknow Internet Knowledge.

>=20

> I understand your journey firsthand - =

personally sold five-plus companies, and that's precisely why I founded The=

Advisory, to assist founders like yourself in selling their businesses.

>=20

> Through my previous ventures, my work led to features in Forbes 30 =

under 30 and an INC 5000 CEO designation, and currently, The Advisory holds=

a ranking as a leading investment bank in the US.

>=20

> Valuations are very high right now - we see companies in your space go =

for up to 10x.

>=20

> Would you be open to a brief call early next week?

>=20

> Oliver Bogner

> Managing Partner | The Advisory Investment Bank

> Q1 2026 #1 Lower Middle Market Investment Bank on Axial

> 5x Top 5 Lower Middle Market Investment Bank on Axial

> 2x Forbes 30 Under 30 Alumni | 2x Inc 5,000 CEO

>

Canada Bread scandal phish from Japan

X-Mozilla-Status: 0001

X-Mozilla-Status2: 00000000

Return-path:

Envelope-to: dave@nk.ca

Delivery-date: Thu, 20 Aug 2026 07:43:00 -0600

Received: from plab.co.jp ([61.126.17.40]:37880)

by doctor.nl2k.ab.ca with esmtps (TLS1.3) tls TLS_AES_256_GCM_SHA384

(Exim 4.99.5 (FreeBSD))

(envelope-from )

id 1wx31o-00000000EQA-2TW6

for dave@nk.ca;

Thu, 20 Aug 2026 07:42:04 -0600

Received: from EC2AMAZ-K59C7BB (ec2-43-207-65-189.ap-northeast-1.compute.amazonaws.com [43.207.65.189])

by plab.co.jp (Postfix) with ESMTPA id 921D2692F8C

for ; Thu, 20 Aug 2026 22:41:06 +0900 (JST)

Authentication-Results: plab.co.jp; arc=none smtp.remote-ip=43.207.65.189

ARC-Seal: i=1; a=rsa-sha256; d=bizmw.com; s=default; t=1787233266; cv=none;

b=nBFcqjYeZ8JiOodaXXR+B/q3SkLcz023mLn/HpEBUb2zEN6zlNsL3+jaF4UdD05rrQ3UT1TxLTU2iznU8lLd/OgyCcBCZkJJz7bhNvm3rgX2UFGidkY5h5F0rNUbG9k2caoZXnRijgXNx1b1lTilbT5Pyi/eNovKnJ4gNxs3SVU=

ARC-Message-Signature: i=1; a=rsa-sha256; d=bizmw.com; s=default;

t=1787233266; c=relaxed/relaxed;

bh=j+E2PBgVHE/LH8aV7yLr3FGKR5M0gxqwBBH63GLDPdc=;

h=DKIM-Signature:MIME-Version:From:To:Date:Subject; b=gzEVXCzGfXCycinznA+gbvHYwDbi9ZufcRGviuy64KW9itJtu5y00g6QmFm6h1XDFPmCnn0SO9uS9lP1hSMFUIy4b2+IrTb/VLhxZFWmCcWVNQw4/QS75uARZCasacMEC+lvNHw2s42Wfts+O896fbGHz1pnDfUCXZuYtx5a8YY=

ARC-Authentication-Results: i=1; plab.co.jp

DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=plab.co.jp; s=bizmw;

t=1787233266; bh=j+E2PBgVHE/LH8aV7yLr3FGKR5M0gxqwBBH63GLDPdc=;

h=From:To:Date:Subject:From;

b=nQrc7zex472JQpF1DZ7kW85LI9RErsMZLlGn/tPYCaOJ2XvUwMgNJb/DQvyeTCRN2

ameS3BKQiz5eOY7ifT9k2K2INv3t1pmMcReckfHazfDvAE3dUzR6fEBAMAyFNU4bYi

uJ9gDldn4iJkyCB0JFwCe25Zf5jpewqgp8izEJKk=

MIME-Version: 1.0

From: "Ontario Class Information"

To: dave@nk.ca

Date: 20 Aug 2026 13:41:06 +0000

Subject: =?utf-8?B?TG9ibGF3L1dlc3RvbiBTZXR0bGVtZW50OiBFbGlnaWJpbGl0?=

=?utf-8?B?eSBJbmZvcm1hdGlvbiBSZWYgTm/CuiA6IDA0MzgwMjA4NjQgOC8yMC8y?=

=?utf-8?B?MDI2IDE6NDE6MDYgUE0=?=

Content-Type: multipart/alternative;

boundary=--boundary_14317_722a606c-fd9e-4cda-bb0b-3921d48749a6

X-Spam_score: 10.1

X-Spam_score_int: 101

X-Spam_bar: ++++++++++

X-Spam_report: Spam detection software, running on the system "doctor.nl2k.ab.ca",

has identified this incoming email as possible spam. The original

message has been attached to this so you can view it or label

similar future email. If you have any questions, see

@@CONTACT_ADDRESS@@ for details.



Content preview:
xmlns:v="urn:schemas-microsoft-com:vml" xmlns:o="urn:schemas-microsoft-com:office:office">




Content analysis details: (10.1 points, 5.0 required)



pts rule name description

---- ---------------------- --------------------------------------------------

0.1 MISSING_MID Missing Message-Id: header

1.0 RCVD_IN_WSFF RBL: Received via a relay in will-spam-for-food.eu.org

[43.207.65.189 listed in will-spam-for-food.eu.org]

[43.207.65.189 listed in will-spam-for-food.eu.org]

[43.207.65.189 listed in will-spam-for-food.eu.org]

[43.207.65.189 listed in will-spam-for-food.eu.org]

[43.207.65.189 listed in will-spam-for-food.eu.org]

[43.207.65.189 listed in will-spam-for-food.eu.org]

[43.207.65.189 listed in will-spam-for-food.eu.org]

[43.207.65.189 listed in will-spam-for-food.eu.org]

[61.126.17.40 listed in will-spam-for-food.eu.org]

[61.126.17.40 listed in will-spam-for-food.eu.org]

[61.126.17.40 listed in will-spam-for-food.eu.org]

[61.126.17.40 listed in will-spam-for-food.eu.org]

[61.126.17.40 listed in will-spam-for-food.eu.org]

[61.126.17.40 listed in will-spam-for-food.eu.org]

[61.126.17.40 listed in will-spam-for-food.eu.org]

[61.126.17.40 listed in will-spam-for-food.eu.org]

1.5 RCVD_IN_AHBL RBL: AHBL: sender is listed in dnsbl.ahbl.org

[43.207.65.189 listed in dnsbl.ahbl.org]

[43.207.65.189 listed in dnsbl.ahbl.org]

[43.207.65.189 listed in dnsbl.ahbl.org]

[43.207.65.189 listed in dnsbl.ahbl.org]

[61.126.17.40 listed in dnsbl.ahbl.org]

[61.126.17.40 listed in dnsbl.ahbl.org]

[61.126.17.40 listed in dnsbl.ahbl.org]

[61.126.17.40 listed in dnsbl.ahbl.org]

0.0 RCVD_IN_AHBL_RTB RBL: AHBL: Real-Time Blocked in dnsbl.ahbl.org

[43.207.65.189 listed in dnsbl.ahbl.org]

1.5 RCVD_IN_AHBL_SPAM RBL: AHBL: Spam Source in dnsbl.ahbl.org

[43.207.65.189 listed in dnsbl.ahbl.org]

0.5 RCVD_IN_AHBL_SMTP RBL: AHBL: Open SMTP relay in dnsbl.ahbl.org

[43.207.65.189 listed in dnsbl.ahbl.org]

0.5 RCVD_IN_AHBL_PROXY RBL: AHBL: Open Proxy server in dnsbl.ahbl.org

[43.207.65.189 listed in dnsbl.ahbl.org]

1.1 URIBL_GREY Contains an URL listed in the URIBL greylist

[URI: squarespace.com]

-3.0 RCVD_IN_RP_CERTIFIED RBL: Sender in ReturnPath Certified - Contact

cert-sa@returnpath.net

[Excessive Number of Queries | ]

-2.0 RCVD_IN_RP_SAFE RBL: Sender in ReturnPath Safe - Contact

safe-sa@returnpath.net

[Excessive Number of Queries | ]

-0.0 SPF_HELO_PASS SPF: HELO matches SPF record

-0.0 SPF_PASS SPF: sender matches SPF record

-0.0 T_RP_MATCHES_RCVD Envelope sender domain matches handover relay

domain

2.8 FONT_ZERO BODY: Nobody likes invisible fonts in emails

1.3 RCVD_IN_RP_RNBL RBL: Relay in RNBL,

https://senderscore.org/blacklistlookup/

[61.126.17.40 listed in bl.score.senderscore.com]

0.0 HTML_MESSAGE BODY: HTML included in message

0.0 HTML_FONT_SIZE_HUGE BODY: HTML font size is huge

0.0 MIME_BASE64_TEXT RAW: Message text disguised using base64 encoding

4.0 DOS_BODY_HIGH_NO_MID High bit body and no message ID header

0.8 SARE_FROM_SPAM_WORD3 I don't know people named this!

0.0 T_DKIM_INVALID DKIM-Signature header exists but is not valid

0.0 LOTS_OF_MONEY Huge... sums of money

Subject: {SPAM?} =?utf-8?B?TG9ibGF3L1dlc3RvbiBTZXR0bGVtZW50OiBFbGlnaWJpbGl0?=

=?utf-8?B?eSBJbmZvcm1hdGlvbiBSZWYgTm/CuiA6IDA0MzgwMjA4NjQgOC8yMC8y?=

=?utf-8?B?MDI2IDE6NDE6MDYgUE0=?=



Verita Global, LLC



Class Action Claims Administrator





P.O. Box 3355

London, Ontario N6A 4K3



Notice of Class Action Settlement



Re: Loblaw/Weston Packaged Bread Class Actions



You are receiving this notice because you were identified as having claimed a $100–$200 Loblaw Card from the Packaged Bread Loblaw Card Program (2008–2026) and/or registered with the lawyers handling this class action.





Authorized by the Superior Court of Justice for Ontario



Class actions have been certified/authorized by the Ontario Superior Court of Justice and the Superior Court of Quebec on behalf of all individuals and businesses resident in Canada who purchased Packaged Bread, alleging certain manufacturers and retailers engaged in anticompetitive conduct resulting in overcharges. The Courts have not yet made any decision on the merits of the claims or defences in either action.



The Plaintiffs have entered into a national settlement with Loblaw Companies Limited, Loblaws Inc., George Weston Limited, Weston Foods (Canada) Inc., Weston Bakeries Limited, and Weston Food Distribution Inc. (collectively “Loblaw/Weston”) for $500 million ($96 million already paid), plus their cooperation pursuing claims against non-settling defendants. In exchange, Settlement Class Members release Loblaw/Weston from claims relating to Packaged Bread.



If approved by both Courts, net settlement funds will be distributed to Settlement Class Members per the approved distribution protocol. Funds for personal-consumption purchasers will be distributed through a claims process; funds for resale purchasers will be held in trust pending a future Court determination.



Canadian Settlement Class Members’ Options



If you reside anywhere in Canada, except Quebec, and purchased Packaged Bread between January 1, 2008 and December 31, 2025, and wish to participate, you do not need to do anything to be included in the Ontario Settlement Class.

Apply Now



For more information and to exercise your rights, read the full Notice at

www.canadianbreadsettlement.ca



A further Notice will be published with details on how eligible Settlement Class Members may claim compensation once the Loblaw/Weston Agreement is approved.





Class Counsel

Strosberg Wingfield Sasso LLP – www.swslitigation.com

Orr Taylor LLP – www.orrtaylor.com



Sincerely,



Verita Global, LLC



Claims Administrator



P.O. Box 3355 | London, Ontario | N6A 4K3 | Canada

DoNotReply@m.veritacanada.com



If you no longer wish to receive these notices, you can unsubscribe here.







Virtual assistant spam from Google Gmail

X-Mozilla-Status: 0001

X-Mozilla-Status2: 00000000

Return-path:

Envelope-to: dave@doctor.nl2k.ab.ca

Delivery-date: Thu, 20 Aug 2026 07:52:00 -0600

Received: from doctor by doctor.nl2k.ab.ca with local (Exim 4.99.5 (FreeBSD))

(envelope-from )

id 1wx3Ac-00000000Gsi-1Bir

for dave@doctor.nl2k.ab.ca;

Thu, 20 Aug 2026 07:51:02 -0600

Resent-From: The Doctor

Resent-Date: Thu, 20 Aug 2026 07:51:02 -0600

Resent-Message-ID:

Resent-To: Dave Yadallee

Received: from mail-oo1-f54.google.com ([209.85.161.54]:59611)

by doctor.nl2k.ab.ca with esmtps (TLS1.3) tls TLS_AES_128_GCM_SHA256

(Exim 4.99.5 (FreeBSD))

(envelope-from )

id 1wx2Zg-000000009TK-02Dg

for root@nk.ca;

Thu, 20 Aug 2026 07:13:02 -0600

Received: by mail-oo1-f54.google.com with SMTP id 006d021491bc7-6b13735e47dso1497714eaf.2

for ; Thu, 20 Aug 2026 06:12:04 -0700 (PDT)

DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed;

d=gmail.com; s=20251104; t=1787231518; x=1787836318; darn=nk.ca;

h=date:organization:mime-version:content-type:to:subject:from

:message-id:from:to:cc:subject:date:message-id:reply-to:content-type;

bh=vdT+HHqOd3kNH6BQiwWuqOX3VmPub3pzSYD7dH6DIAI=;

b=nTRRdYQwQifuLJ3KCxnLNMCIYbER7M7HaooU0tlrvbsaWl4OFLYh0cbJ5wtrpqtq7w

ZXf5avkMTAK0FGfaCFBvly4ci8+yH2jm0EepubT6L2OEO98QRSIirNTZNV4WTuuraSIk

3hpzNsX9v4zn0K4jPEFqVoGsll8uJe3mgCNAIfWe2uGsyLkknXy1Y/j4oglkRrdnQv7r

bJGMqYQHBXMv3mdWiHBjlcHsTBjVxRZbPHguiUaWg7SrxfbacLK+pQj73I28llZW+PuO

5dCZEhnPATNgj1awIYRThqORxpUKZswiArguK0TSr4+R+edKE1qhoi0T5Jdw16ysE4oS

d3Iw==

X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed;

d=1e100.net; s=20251104; t=1787231518; x=1787836318;

h=date:organization:mime-version:content-type:to:subject:from

:message-id:x-gm-gg:x-gm-message-state:from:to:cc:subject:date

:message-id:reply-to:content-type;

bh=vdT+HHqOd3kNH6BQiwWuqOX3VmPub3pzSYD7dH6DIAI=;

b=p0G5KKPod6TcDLZWbS2CDtRm0a4UyNMmuYtDlPMjnhMLC/iyLxV7zgMxJM+DH3stnl

JvjoSYn9SZBHF/+dcJ6ocAkQ+MVoRLr8Jc5c2pqCLCIuJT6HgL8jx+qyKcEY/nLykCOD

enQziU2pq1oVJBaJt154kvCKE12MB320y3cYTW63bMeU9AompQnKzjQd13d+jFrrd8S8

840Z0KqZzGluElYfxzsj56vig63UmbFW489jBJBYdOO279i8Cs/YDK/mYCtrjTx8JK+P

Ua9jPy7GI/OEBabFU+c9aj8OO1qSACzmk4eJgQwjQh52KozarXd16HjwyoWlmpqixH7r

mNIw==

X-Gm-Message-State: AOJu0YyFgYn2uBXbNDlHk6BrysOs3frz8LCBuctVM/eoUktufSIR4OJw

KT3uEHkmGI4Om296idilSt31ePPt1CoUfZqmriIBxuboZ7GlwHt7trsN6tbazA==

X-Gm-Gg: AR+sD11rmCtftthw7LeRUl1aF9aZTY1+EFeSQ7tR0LKW2W0eHxZJuJg+FX31iM0CX3X

k7jjtyby9LiYitGluDCd1lIpvmP0bP1cA0GYWlV1TdKHvJwUx21zIdfETY0KIAAlHygPsqhWx71

NgD1g4+Q6dVGWYna4sAPnr1RODtOOAz5L1jyow6ueWi0iIeZfLD65sGEOCcBZozRoDqGj7obj/y

NmrIeGKsmj6o8Twwhw3kcId51z0rTW3+4JMsUSkWoD53tFrwdAkk4W/04MaIwvZKdKAJuJIODlF

KrKOKaFuvTXUHvJbaL8qg4k1aWT3iEoOwR7Y+d+HEg09pTRPb29vEcHWlEgO+K2L70A/j6BLZvf

oHoVQaFw4TwU8oWsldnSNMRcscaPi04rEq+CpUSLc6g2WEut8VWC4cnw+v+hCMW4pATWFG1hbcX

3ca9wHRIhFdt49PiScc6qY253ZLhgNs0Ga6P6szZ9FOyUJ9T+mJDZZ3qYVG/DYptJlAj+83UQ=

X-Received: by 2002:a05:6820:4cc1:b0:6b0:ae64:b307 with SMTP id 006d021491bc7-6b13c34429bmr12055840eaf.10.1787231517726;

Thu, 20 Aug 2026 06:11:57 -0700 (PDT)

Received: from gmail.com ([122.160.196.13])

by smtp.gmail.com with ESMTPSA id 5a478bee46e88-327bf10a94dsm16860470eec.15.2026.08.20.06.11.54

for

(version=TLS1_2 cipher=ECDHE-ECDSA-AES128-GCM-SHA256 bits=128/128);

Thu, 20 Aug 2026 06:11:56 -0700 (PDT)

Message-ID: <6a86fd1c.92d2873c.12c24f.60b5@mx.google.com>

From: Elva

X-Google-Original-From: "Elva"

Subject: Re: Hii, Good Morning! Reminder ## Remote VA Support. root@nk.ca My

Name is Elva

To: "root"

Content-Type: multipart/alternative; boundary="5jFxYm3aiw9V94vENEBCYuDVaj=_oWPokm"

MIME-Version: 1.0

Organization: Headfield Solutions Pvt Ltd

Date: Thu, 20 Aug 2026 18:41:56 +0530

X-Spam_score: 9.7

X-Spam_score_int: 97

X-Spam_bar: +++++++++

X-Spam_report: Spam detection software, running on the system "doctor.nl2k.ab.ca",

has identified this incoming email as possible spam. The original

message has been attached to this so you can view it or label

similar future email. If you have any questions, see

@@CONTACT_ADDRESS@@ for details.



Content preview: Hi Good Morning! I sent you an email on Friday but didn’t

hear back. Happy to schedule a quick call. We offer Affordable Remote VA

Support. Thank you! Elva, VA Team! On Apr 10, 2026, at 12:35 PM, Elva wrote:





Content analysis details: (9.7 points, 5.0 required)



pts rule name description

---- ---------------------- --------------------------------------------------

1.0 RCVD_IN_WSFF RBL: Received via a relay in will-spam-for-food.eu.org

[122.160.196.13 listed in will-spam-for-food.eu.org]

[122.160.196.13 listed in will-spam-for-food.eu.org]

[122.160.196.13 listed in will-spam-for-food.eu.org]

[122.160.196.13 listed in will-spam-for-food.eu.org]

[122.160.196.13 listed in will-spam-for-food.eu.org]

[122.160.196.13 listed in will-spam-for-food.eu.org]

[122.160.196.13 listed in will-spam-for-food.eu.org]

[122.160.196.13 listed in will-spam-for-food.eu.org]

[209.85.161.54 listed in will-spam-for-food.eu.org]

[209.85.161.54 listed in will-spam-for-food.eu.org]

[209.85.161.54 listed in will-spam-for-food.eu.org]

[209.85.161.54 listed in will-spam-for-food.eu.org]

[209.85.161.54 listed in will-spam-for-food.eu.org]

[209.85.161.54 listed in will-spam-for-food.eu.org]

[209.85.161.54 listed in will-spam-for-food.eu.org]

[209.85.161.54 listed in will-spam-for-food.eu.org]

1.5 RCVD_IN_AHBL RBL: AHBL: sender is listed in dnsbl.ahbl.org

[209.85.161.54 listed in dnsbl.ahbl.org]

[209.85.161.54 listed in dnsbl.ahbl.org]

[209.85.161.54 listed in dnsbl.ahbl.org]

[209.85.161.54 listed in dnsbl.ahbl.org]

[122.160.196.13 listed in dnsbl.ahbl.org]

[122.160.196.13 listed in dnsbl.ahbl.org]

[122.160.196.13 listed in dnsbl.ahbl.org]

[122.160.196.13 listed in dnsbl.ahbl.org]

0.5 RCVD_IN_AHBL_PROXY RBL: AHBL: Open Proxy server in dnsbl.ahbl.org

[209.85.161.54 listed in dnsbl.ahbl.org]

0.0 RCVD_IN_AHBL_RTB RBL: AHBL: Real-Time Blocked in dnsbl.ahbl.org

[209.85.161.54 listed in dnsbl.ahbl.org]

1.5 RCVD_IN_AHBL_SPAM RBL: AHBL: Spam Source in dnsbl.ahbl.org

[209.85.161.54 listed in dnsbl.ahbl.org]

0.5 RCVD_IN_AHBL_SMTP RBL: AHBL: Open SMTP relay in dnsbl.ahbl.org

[209.85.161.54 listed in dnsbl.ahbl.org]

-3.0 RCVD_IN_RP_CERTIFIED RBL: Sender in ReturnPath Certified - Contact

cert-sa@returnpath.net

[Excessive Number of Queries | ]

-2.0 RCVD_IN_RP_SAFE RBL: Sender in ReturnPath Safe - Contact

safe-sa@returnpath.net

[Excessive Number of Queries | ]

3.6 RCVD_IN_SBL_CSS RBL: Received via a relay in Spamhaus SBL-CSS

[122.160.196.13 listed in zen.spamhaus.org]

1.5 RCVD_IN_SBL_XBL RBL: Received via a relay in Spamhaus SBL+XBL

[122.160.196.13 listed in sbl-xbl.spamhaus.org]

-0.0 SPF_PASS SPF: sender matches SPF record

0.2 MR_NOT_ATTRIBUTED_IP Beta rule: an non-attributed IPv4 found in

headers

1.4 FSL_HELO_FAKE No description available.

0.2 FREEMAIL_ENVFROM_END_DIGIT Envelope-from freemail username ends in

digit

[elvaterra987(at)gmail.com]

0.0 FREEMAIL_FROM Sender email is commonly abused enduser mail provider

[elvaterra987(at)gmail.com]

-0.0 RCVD_IN_DNSWL_NONE RBL: Sender listed at http://www.dnswl.org/, no

trust

[209.85.161.54 listed in list.dnswl.org]

1.0 OPT_OUT BODY: No description available.

0.5 L_HELLO_ADDRESS BODY: Greets you by address, not by name

-0.0 RCVD_IN_MSPIKE_H3 RBL: Good reputation (+3)

[209.85.161.54 listed in wl.mailspike.net]

1.3 RCVD_IN_RP_RNBL RBL: Relay in RNBL,

https://senderscore.org/blacklistlookup/

[209.85.161.54 listed in bl.score.senderscore.com]

0.0 HTML_MESSAGE BODY: HTML included in message

0.0 HTML_FONT_SIZE_HUGE BODY: HTML font size is huge

0.0 NO_RDNS2 Sending MTA has no reverse DNS

0.0 T_DKIM_INVALID DKIM-Signature header exists but is not valid

-0.0 RCVD_IN_MSPIKE_WL Mailspike good senders

Subject: {SPAM?} Re: Hii, Good Morning! Reminder ## Remote VA Support. root@nk.ca My

Name is Elva



This is a multi-part message in MIME format



--5jFxYm3aiw9V94vENEBCYuDVaj=_oWPokm

Content-Type: text/plain; charset="utf-8"

Content-Transfer-Encoding: quoted-printable

Content-Disposition: inline



Hi Good Morning!

I sent you an email on Friday but didn=E2=80=99t hear back.

Happy to schedule a quick call. We offer Affordable Remote VA Support.=



Thank you!

Elva,

VA Team!



On Apr 10, 2026, at 12:35=E2=80=AFPM, Elva w=

rote:



Hi, root@nk.ca



Hope you are doing well=E2=80=A6



Please, could you let me know whether you are interested in hiring a r=

emote Virtual Assistant at a reasonable cost?



What we can handle for you:



=F0=9F=91=89 Admin & Data Entry



=F0=9F=91=89 Email & Calendar Management



=F0=9F=91=89 Cold Calling & Outreach



=F0=9F=91=89 social media & Lead Generation



=F0=9F=91=89 Customer Support



=F0=9F=91=89 Online Research



=F0=9F=91=89 CRM Management



=F0=9F=91=89 Bookkeeping Assistance



=F0=9F=91=89 Appointment Scheduling



=F0=9F=91=89 Document Preparation



=F0=9F=91=89 Real Estate & E-commerce Support



=F0=9F=91=89 Studio-quality 3D Rendering



=F0=9F=91=89 SEO & Digital Marketing



=F0=9F=91=89 Website Development



=F0=9F=91=89 Mobile App Development



=F0=9F=91=89 LPO =E2=80=93 Legal Process Outsourcing



=F0=9F=91=89 RPO =E2=80=93 Recruitment Process Outsourcing



=F0=9F=91=89 Video Editing Support



We provide reliable, affordable, and results-driven remote support tai=

lored to your business needs?



Would you be open to a quick call this week?



Best Regards,

Elva,

VA Team

Note: If this isn=E2=80=99t relevant, feel free to reply =E2=80=9COpt-=

out=E2=80=9D





--5jFxYm3aiw9V94vENEBCYuDVaj=_oWPokm

Content-Type: text/html; charset="utf-8"

Content-Transfer-Encoding: quoted-printable

Content-Disposition: inline



Hi Good Morning!
I sen=

t you an email on Friday but didn=E2=80=99t hear back.
Happy to sch=

edule a quick call. We offer Affordable Remote VA Support.
Thank yo=

u!
Elva,
VA Team!

On Apr 10, 2026, at 12:35=E2=80=AFPM,&nb=

sp; Elva <Elvaterra987@Gmail.Com> wrote:

Hi, root@nk.ca
>

Hope you are doing well=E2=80=A6

Please, could you let me kn=

ow whether you are interested in hiring a remote Virtual Assistant at =

a reasonable cost?

What we can handle for you:

=F0=9F=91=89=

Admin & Data Entry

=F0=9F=91=89 Email & Calendar Manage=

ment

=F0=9F=91=89 Cold Calling & Outreach

=F0=9F=91=89=

social media & Lead Generation

=F0=9F=91=89 Customer Suppor=

t

=F0=9F=91=89 Online Research

=F0=9F=91=89 CRM Management=

=F0=9F=91=89 Bookkeeping Assistance

=F0=9F=91=89 Appointm=

ent Scheduling

=F0=9F=91=89 Document Preparation

=F0=9F=91=

=89 Real Estate & E-commerce Support

=F0=9F=91=89 Studio-qua=

lity 3D Rendering

=F0=9F=91=89 SEO & Digital Marketing


>=F0=9F=91=89 Website Development

=F0=9F=91=89 Mobile App Develo=

pment

=F0=9F=91=89 LPO =E2=80=93 Legal Process Outsourcing


>=F0=9F=91=89 RPO =E2=80=93 Recruitment Process Outsourcing

=F0=9F=

=91=89 Video Editing Support

We provide reliable, affordable, an=

d results-driven remote support tailored to your business needs?


>Would you be open to a quick call this week?

Best Regards,
E=

lva,
VA Team
Note: If this isn=E2=80=99t relevant, feel free to =

reply =E2=80=9COpt-out=E2=80=9D







--5jFxYm3aiw9V94vENEBCYuDVaj=_oWPokm--



Canada Bread scandal phish from Japan

X-Mozilla-Status: 0001

X-Mozilla-Status2: 00000000

Return-path:

Envelope-to: dave@doctor.nl2k.ab.ca

Delivery-date: Thu, 20 Aug 2026 07:51:00 -0600

Received: from doctor by doctor.nl2k.ab.ca with local (Exim 4.99.5 (FreeBSD))

(envelope-from )

id 1wx3AQ-00000000Gqd-04mA

for dave@doctor.nl2k.ab.ca;

Thu, 20 Aug 2026 07:50:50 -0600

Resent-From: The Doctor

Resent-Date: Thu, 20 Aug 2026 07:50:49 -0600

Resent-Message-ID:

Resent-To: Dave Yadallee

Received: from linkup-net.co.jp ([122.17.181.120]:45416)

by doctor.nl2k.ab.ca with esmtps (TLS1.3) tls TLS_AES_256_GCM_SHA384

(Exim 4.99.5 (FreeBSD))

(envelope-from )

id 1wx24o-000000004WF-42KX

for root@nl2k.ab.ca;

Thu, 20 Aug 2026 06:41:07 -0600

Received: from EC2AMAZ-K59C7BB (ec2-43-207-65-189.ap-northeast-1.compute.amazonaws.com [43.207.65.189])

by linkup-net.co.jp (Postfix) with ESMTPA id 3A0182AD8ACA

for ; Thu, 20 Aug 2026 21:40:04 +0900 (JST)

Authentication-Results: linkup-net.co.jp; arc=none smtp.remote-ip=43.207.65.189

ARC-Seal: i=1; a=rsa-sha256; d=bizmw.com; s=default; t=1787229604; cv=none;

b=SZiLTbvuUyngozL6MeYOXc6acFik1XJMODyKnA/ywz4bRSuwjpLngbgzzEqVaa1rwcsoyXNf+J0Ai23DnyKZyDeS5qKrFimmKSHxMZo8pSTm10zEIUcQG8c+Uz8AaieQCA0rJ9hNHqKrbROPJiy6w3gdpCYT1ePdJNNL4Irj0+A=

ARC-Message-Signature: i=1; a=rsa-sha256; d=bizmw.com; s=default;

t=1787229604; c=relaxed/relaxed;

bh=WEr3lBaLX2huenFaTqzF9yLHEsTgBeT37aValPpDaBw=;

h=DKIM-Signature:MIME-Version:From:To:Date:Subject; b=kd3S572o9zha03O6IyXw0tOpsdqxH0a2Y8S74209GR2gYGsYg+teZCXVwNxkAbi1EjYTxtfXpGq7pQRkRRVqsL1cDciDytG7uoflknpKrPzufc6KbVW9sdhmt+u/kv0K+zUKhS161SXwX7rTKkteIBk5DaHaOEcsGU8e2xrQuKg=

ARC-Authentication-Results: i=1; linkup-net.co.jp

DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=linkup-net.co.jp;

s=bizmw; t=1787229604;

bh=WEr3lBaLX2huenFaTqzF9yLHEsTgBeT37aValPpDaBw=;

h=From:To:Date:Subject:From;

b=dn69/XUVoBvg1DO1n5uxziMsVeaRNtuUG5Gu4fhEb8wc9mFrQp1ivhFkACzFR/if1

GyYCRI2oiOi14hhFROOcXXeXj/SeHohix20OyncasNcSo2N5aFvQMILMAOE4udNNit

TE+nzcUVYUGpiehsNpoaxGAc0LF30JF8XqMJfmhc=

MIME-Version: 1.0

From: "Class Action Settlement Info"

To: root@nl2k.ab.ca

Date: 20 Aug 2026 12:40:02 +0000

Subject: =?utf-8?B?Tm90aWNlIFJlZ2FyZGluZyBTZXR0bGVtZW50IEJlbmVmaXRz?=

=?utf-8?B?IFJlZiBOb8K6IDogODM4NjA2MjE1OCA4LzIwLzIwMjYgMTI6NDA6MDIg?=

=?utf-8?B?UE0=?=

Content-Type: multipart/alternative;

boundary=--boundary_11455_88200529-44ec-49c0-9600-f0f2be1e0ff1

X-Spam_score: 10.3

X-Spam_score_int: 103

X-Spam_bar: ++++++++++

X-Spam_report: Spam detection software, running on the system "doctor.nl2k.ab.ca",

has identified this incoming email as possible spam. The original

message has been attached to this so you can view it or label

similar future email. If you have any questions, see

@@CONTACT_ADDRESS@@ for details.



Content preview:
xmlns:v="urn:schemas-microsoft-com:vml" xmlns:o="urn:schemas-microsoft-com:office:office">




Content analysis details: (10.3 points, 5.0 required)



pts rule name description

---- ---------------------- --------------------------------------------------

0.1 MISSING_MID Missing Message-Id: header

1.0 RCVD_IN_WSFF RBL: Received via a relay in will-spam-for-food.eu.org

[43.207.65.189 listed in will-spam-for-food.eu.org]

[43.207.65.189 listed in will-spam-for-food.eu.org]

[43.207.65.189 listed in will-spam-for-food.eu.org]

[43.207.65.189 listed in will-spam-for-food.eu.org]

[43.207.65.189 listed in will-spam-for-food.eu.org]

[43.207.65.189 listed in will-spam-for-food.eu.org]

[43.207.65.189 listed in will-spam-for-food.eu.org]

[43.207.65.189 listed in will-spam-for-food.eu.org]

[122.17.181.120 listed in will-spam-for-food.eu.org]

[122.17.181.120 listed in will-spam-for-food.eu.org]

[122.17.181.120 listed in will-spam-for-food.eu.org]

[122.17.181.120 listed in will-spam-for-food.eu.org]

[122.17.181.120 listed in will-spam-for-food.eu.org]

[122.17.181.120 listed in will-spam-for-food.eu.org]

[122.17.181.120 listed in will-spam-for-food.eu.org]

[122.17.181.120 listed in will-spam-for-food.eu.org]

1.5 RCVD_IN_AHBL RBL: AHBL: sender is listed in dnsbl.ahbl.org

[122.17.181.120 listed in dnsbl.ahbl.org]

[122.17.181.120 listed in dnsbl.ahbl.org]

[122.17.181.120 listed in dnsbl.ahbl.org]

[122.17.181.120 listed in dnsbl.ahbl.org]

[43.207.65.189 listed in dnsbl.ahbl.org]

[43.207.65.189 listed in dnsbl.ahbl.org]

[43.207.65.189 listed in dnsbl.ahbl.org]

[43.207.65.189 listed in dnsbl.ahbl.org]

0.5 RCVD_IN_AHBL_SMTP RBL: AHBL: Open SMTP relay in dnsbl.ahbl.org

[122.17.181.120 listed in dnsbl.ahbl.org]

0.5 RCVD_IN_AHBL_PROXY RBL: AHBL: Open Proxy server in dnsbl.ahbl.org

[122.17.181.120 listed in dnsbl.ahbl.org]

0.0 RCVD_IN_AHBL_RTB RBL: AHBL: Real-Time Blocked in dnsbl.ahbl.org

[122.17.181.120 listed in dnsbl.ahbl.org]

1.5 RCVD_IN_AHBL_SPAM RBL: AHBL: Spam Source in dnsbl.ahbl.org

[122.17.181.120 listed in dnsbl.ahbl.org]

-3.0 RCVD_IN_RP_CERTIFIED RBL: Sender in ReturnPath Certified - Contact

cert-sa@returnpath.net

[Excessive Number of Queries | ]

-2.0 RCVD_IN_RP_SAFE RBL: Sender in ReturnPath Safe - Contact

safe-sa@returnpath.net

[Excessive Number of Queries | ]

1.1 URIBL_GREY Contains an URL listed in the URIBL greylist

[URI: squarespace.com]

-0.0 SPF_HELO_PASS SPF: HELO matches SPF record

-0.0 SPF_PASS SPF: sender matches SPF record

0.2 MR_NOT_ATTRIBUTED_IP Beta rule: an non-attributed IPv4 found in

headers

-0.0 T_RP_MATCHES_RCVD Envelope sender domain matches handover relay

domain

2.8 FONT_ZERO BODY: Nobody likes invisible fonts in emails

1.3 RCVD_IN_RP_RNBL RBL: Relay in RNBL,

https://senderscore.org/blacklistlookup/

[122.17.181.120 listed in bl.score.senderscore.com]

0.0 HTML_MESSAGE BODY: HTML included in message

0.0 HTML_FONT_SIZE_HUGE BODY: HTML font size is huge

0.0 MIME_BASE64_TEXT RAW: Message text disguised using base64 encoding

0.0 LOTS_OF_MONEY Huge... sums of money

0.0 T_DKIM_INVALID DKIM-Signature header exists but is not valid

4.0 DOS_BODY_HIGH_NO_MID High bit body and no message ID header

0.8 SARE_FROM_SPAM_WORD3 I don't know people named this!

Subject: {SPAM?} =?utf-8?B?Tm90aWNlIFJlZ2FyZGluZyBTZXR0bGVtZW50IEJlbmVmaXRz?=

=?utf-8?B?IFJlZiBOb8K6IDogODM4NjA2MjE1OCA4LzIwLzIwMjYgMTI6NDA6MDIg?=

=?utf-8?B?UE0=?=









Verita Global, LLC



Class Action Claims Administrator





P.O. Box 3355

London, Ontario N6A 4K3



Notice of Class Action Settlement



Re: Loblaw/Weston Packaged Bread Class Actions



You are receiving this notice because you were identified as having claimed a $100–$200 Loblaw Card from the Packaged Bread Loblaw Card Program (2008–2026) and/or registered with the lawyers handling this class action.





Authorized by the Superior Court of Justice for Ontario



Class actions have been certified/authorized by the Ontario Superior Court of Justice and the Superior Court of Quebec on behalf of all individuals and businesses resident in Canada who purchased Packaged Bread, alleging certain manufacturers and retailers engaged in anticompetitive conduct resulting in overcharges. The Courts have not yet made any decision on the merits of the claims or defences in either action.



The Plaintiffs have entered into a national settlement with Loblaw Companies Limited, Loblaws Inc., George Weston Limited, Weston Foods (Canada) Inc., Weston Bakeries Limited, and Weston Food Distribution Inc. (collectively “Loblaw/Weston”) for $500 million ($96 million already paid), plus their cooperation pursuing claims against non-settling defendants. In exchange, Settlement Class Members release Loblaw/Weston from claims relating to Packaged Bread.



If approved by both Courts, net settlement funds will be distributed to Settlement Class Members per the approved distribution protocol. Funds for personal-consumption purchasers will be distributed through a claims process; funds for resale purchasers will be held in trust pending a future Court determination.



Canadian Settlement Class Members’ Options



If you reside anywhere in Canada, except Quebec, and purchased Packaged Bread between January 1, 2008 and December 31, 2025, and wish to participate, you do not need to do anything to be included in the Ontario Settlement Class.

Apply Now



For more information and to exercise your rights, read the full Notice at

www.canadianbreadsettlement.ca



A further Notice will be published with details on how eligible Settlement Class Members may claim compensation once the Loblaw/Weston Agreement is approved.





Class Counsel

Strosberg Wingfield Sasso LLP – www.swslitigation.com

Orr Taylor LLP – www.orrtaylor.com



Sincerely,



Verita Global, LLC



Claims Administrator



P.O. Box 3355 | London, Ontario | N6A 4K3 | Canada

DoNotReply@m.veritacanada.com



If you no longer wish to receive these notices, you can unsubscribe here.





Bread scandal phish from Japan

X-Mozilla-Status: 0001

X-Mozilla-Status2: 00000000

Return-path:

Envelope-to: dave@doctor.nl2k.ab.ca

Delivery-date: Thu, 20 Aug 2026 06:24:00 -0600

Received: from doctor by doctor.nl2k.ab.ca with local (Exim 4.99.5 (FreeBSD))

(envelope-from )

id 1wx1no-00000000KrH-3Wmh

for dave@doctor.nl2k.ab.ca;

Thu, 20 Aug 2026 06:23:24 -0600

Resent-From: The Doctor

Resent-Date: Thu, 20 Aug 2026 06:23:24 -0600

Resent-Message-ID:

Resent-To: Dave Yadallee

Received: from kajin.jp ([116.80.20.174]:38915)

by doctor.nl2k.ab.ca with esmtps (TLS1.3) tls TLS_AES_256_GCM_SHA384

(Exim 4.99.5 (FreeBSD))

(envelope-from )

id 1wx1mq-00000000FpY-2j79

for root@nk.ca;

Thu, 20 Aug 2026 06:22:32 -0600

Received: (qmail 843660 invoked by VF by uid 0); 20 Aug 2026 21:21:33 +0900

X-Vade-Tracker: score=500, verdict=spam:high, state=1

spamcause=gggruggvucftvghtrhhoucdtuddrgeefiedrtddugdduvdektdehucetufdoteggodetrfdotffvucfrrhhofhhilhgvmecupffvvffrveenuceurghilhhouhhtmecufedttdenucgohfhorhgsihguuggvnhfkphfpvghtfihorhhkucdlhedttddmnecujfgurhepggfhvfffufgtsegrtddtredttdejnecuhfhrohhmpedfufgvthhtlhgvmhgvnhhtucfovghmsggvrhcutfhighhhthhsfdcuoehsuhhpphhorhhtsehkrghjihhnrdhjpheqnecuggftrfgrthhtvghrnhepfeeiueevhefgffevudeggfeludekhfetudevjefhueejtdduteejvedvgeekjeffnecuffhomhgrihhnpegrmhgriihonhgrfihsrdgtohhmpdgtrghnrgguihgrnhgsrhgvrggushgvthhtlhgvmhgvnhhtrdgtrgdpshifshhlihhtihhgrghtihhonhdrtghomhdpohhrrhhtrgihlhhorhdrtghomhenucfkphepfeehrdejjedrjeekrdekvdenucfuphgrmhfkphepfeehrdejjedrjeekrdekvdenucfhohhrsghiugguvghnkfhppfgvthifohhrkhepfeehrdejjedrjeekrdekvdenuceurggutfgvphhuthffohhmrghinheptggrnhgrughirghnsghrvggrughsvghtthhlvghmvghnthdrtggrnecuufhprghmtegunhfuuhgsjhgvtghtpegtlhhllhhllhhllhcutghllhhllhcutghllhhllhhllhemucgtlhhllhhllhhllhhllhhllhhlucgtlhhllhhllhhllhhllhhlucgrrggrucgrrgcumecuugenucevlhhushhtvghrufh

iiigvpedtnecurfgrrhgrmhepihhnvghtpeefhedrjeejrdejkedrkedvpdhhvghlohepgfevvdetofetkgdqlfggiefqhffgqfdpmhgrihhlfhhrohhmpehsuhhpphhorhhtsehkrghjihhnrdhjphdpnhgspghrtghpthhtohepuddprhgtphhtthhopehrohhothesnhhkrdgtrgdpmhhouggvpehsmhhtphhouhht

Received: from unknown (HELO EC2AMAZ-JV6OFEO) (support@kajin.jp@35.77.78.82)

by dc108.etius.jp (116.80.20.174) with ESMTPA; 20 Aug 2026 21:21:33 +0900

MIME-Version: 1.0

From: "Settlement Member Rights"

To: root@nk.ca

Date: 20 Aug 2026 12:21:33 +0000

Subject: =?utf-8?B?Q2FuYWRpYW4gQnJlYWQgQWN0aW9uczogQ2VydGlmaWNhdGlv?=

=?utf-8?B?biBJbmZvcm1hdGlvbiBSZWYgTm/CuiA6IDEyMzI1MTM3NTMgOC8yMC8y?=

=?utf-8?B?MDI2IDEyOjIxOjMzIFBN?=

Content-Type: multipart/alternative;

boundary=--boundary_10139_8ccdc59b-ffc4-47ef-8c87-e7bcd36f2040

X-Spam_score: 9.5

X-Spam_score_int: 95

X-Spam_bar: +++++++++

X-Spam_report: Spam detection software, running on the system "doctor.nl2k.ab.ca",

has identified this incoming email as possible spam. The original

message has been attached to this so you can view it or label

similar future email. If you have any questions, see

@@CONTACT_ADDRESS@@ for details.



Content preview:
xmlns:v="urn:schemas-microsoft-com:vml" xmlns:o="urn:schemas-microsoft-com:office:office">




Content analysis details: (9.5 points, 5.0 required)



pts rule name description

---- ---------------------- --------------------------------------------------

0.1 MISSING_MID Missing Message-Id: header

1.0 RCVD_IN_WSFF RBL: Received via a relay in will-spam-for-food.eu.org

[35.77.78.82 listed in will-spam-for-food.eu.org]

[35.77.78.82 listed in will-spam-for-food.eu.org]

[35.77.78.82 listed in will-spam-for-food.eu.org]

[35.77.78.82 listed in will-spam-for-food.eu.org]

[35.77.78.82 listed in will-spam-for-food.eu.org]

[35.77.78.82 listed in will-spam-for-food.eu.org]

[35.77.78.82 listed in will-spam-for-food.eu.org]

[35.77.78.82 listed in will-spam-for-food.eu.org]

[116.80.20.174 listed in will-spam-for-food.eu.org]

[116.80.20.174 listed in will-spam-for-food.eu.org]

[116.80.20.174 listed in will-spam-for-food.eu.org]

[116.80.20.174 listed in will-spam-for-food.eu.org]

[116.80.20.174 listed in will-spam-for-food.eu.org]

[116.80.20.174 listed in will-spam-for-food.eu.org]

[116.80.20.174 listed in will-spam-for-food.eu.org]

[116.80.20.174 listed in will-spam-for-food.eu.org]

1.5 RCVD_IN_AHBL RBL: AHBL: sender is listed in dnsbl.ahbl.org

[116.80.20.174 listed in dnsbl.ahbl.org]

[116.80.20.174 listed in dnsbl.ahbl.org]

[116.80.20.174 listed in dnsbl.ahbl.org]

[116.80.20.174 listed in dnsbl.ahbl.org]

[35.77.78.82 listed in dnsbl.ahbl.org]

[35.77.78.82 listed in dnsbl.ahbl.org]

[35.77.78.82 listed in dnsbl.ahbl.org]

[35.77.78.82 listed in dnsbl.ahbl.org]

0.0 RCVD_IN_AHBL_RTB RBL: AHBL: Real-Time Blocked in dnsbl.ahbl.org

[116.80.20.174 listed in dnsbl.ahbl.org]

1.5 RCVD_IN_AHBL_SPAM RBL: AHBL: Spam Source in dnsbl.ahbl.org

[116.80.20.174 listed in dnsbl.ahbl.org]

0.5 RCVD_IN_AHBL_SMTP RBL: AHBL: Open SMTP relay in dnsbl.ahbl.org

[116.80.20.174 listed in dnsbl.ahbl.org]

0.5 RCVD_IN_AHBL_PROXY RBL: AHBL: Open Proxy server in dnsbl.ahbl.org

[116.80.20.174 listed in dnsbl.ahbl.org]

-3.0 RCVD_IN_RP_CERTIFIED RBL: Sender in ReturnPath Certified - Contact

cert-sa@returnpath.net

[Excessive Number of Queries | ]

1.1 URIBL_GREY Contains an URL listed in the URIBL greylist

[URI: squarespace.com]

-2.0 RCVD_IN_RP_SAFE RBL: Sender in ReturnPath Safe - Contact

safe-sa@returnpath.net

[Excessive Number of Queries | ]

1.3 RCVD_IN_RP_RNBL RBL: Relay in RNBL,

https://senderscore.org/blacklistlookup/

[116.80.20.174 listed in bl.score.senderscore.com]

-0.0 SPF_HELO_PASS SPF: HELO matches SPF record

-0.0 SPF_PASS SPF: sender matches SPF record

0.2 MR_NOT_ATTRIBUTED_IP Beta rule: an non-attributed IPv4 found in

headers

-0.0 T_RP_MATCHES_RCVD Envelope sender domain matches handover relay

domain

2.8 FONT_ZERO BODY: Nobody likes invisible fonts in emails

0.0 HTML_MESSAGE BODY: HTML included in message

0.0 HTML_FONT_SIZE_HUGE BODY: HTML font size is huge

0.0 MIME_BASE64_TEXT RAW: Message text disguised using base64 encoding

0.0 LOTS_OF_MONEY Huge... sums of money

4.0 DOS_BODY_HIGH_NO_MID High bit body and no message ID header

Subject: {SPAM?} =?utf-8?B?Q2FuYWRpYW4gQnJlYWQgQWN0aW9uczogQ2VydGlmaWNhdGlv?=

=?utf-8?B?biBJbmZvcm1hdGlvbiBSZWYgTm/CuiA6IDEyMzI1MTM3NTMgOC8yMC8y?=

=?utf-8?B?MDI2IDEyOjIxOjMzIFBN?=



Verita Global, LLC



Class Action Claims Administrator





P.O. Box 3355

London, Ontario N6A 4K3



Notice of Class Action Settlement



Re: Loblaw/Weston Packaged Bread Class Actions



You are receiving this notice because you were identified as having claimed a $100–$200 Loblaw Card from the Packaged Bread Loblaw Card Program (2008–2026) and/or registered with the lawyers handling this class action.





Authorized by the Superior Court of Justice for Ontario



Class actions have been certified/authorized by the Ontario Superior Court of Justice and the Superior Court of Quebec on behalf of all individuals and businesses resident in Canada who purchased Packaged Bread, alleging certain manufacturers and retailers engaged in anticompetitive conduct resulting in overcharges. The Courts have not yet made any decision on the merits of the claims or defences in either action.



The Plaintiffs have entered into a national settlement with Loblaw Companies Limited, Loblaws Inc., George Weston Limited, Weston Foods (Canada) Inc., Weston Bakeries Limited, and Weston Food Distribution Inc. (collectively “Loblaw/Weston”) for $500 million ($96 million already paid), plus their cooperation pursuing claims against non-settling defendants. In exchange, Settlement Class Members release Loblaw/Weston from claims relating to Packaged Bread.



If approved by both Courts, net settlement funds will be distributed to Settlement Class Members per the approved distribution protocol. Funds for personal-consumption purchasers will be distributed through a claims process; funds for resale purchasers will be held in trust pending a future Court determination.



Canadian Settlement Class Members’ Options



If you reside anywhere in Canada, except Quebec, and purchased Packaged Bread between January 1, 2008 and December 31, 2025, and wish to participate, you do not need to do anything to be included in the Ontario Settlement Class.

Apply Now



For more information and to exercise your rights, read the full Notice at

www.canadianbreadsettlement.ca



A further Notice will be published with details on how eligible Settlement Class Members may claim compensation once the Loblaw/Weston Agreement is approved.





Class Counsel

Strosberg Wingfield Sasso LLP – www.swslitigation.com

Orr Taylor LLP – www.orrtaylor.com



Sincerely,



Verita Global, LLC



Claims Administrator



P.O. Box 3355 | London, Ontario | N6A 4K3 | Canada

DoNotReply@m.veritacanada.com



If you no longer wish to receive these notices, you can unsubscribe here.







Bread scandal phish from Japan

X-Mozilla-Status: 0001

X-Mozilla-Status2: 00000000

Return-path:

Envelope-to: dave@doctor.nl2k.ab.ca

Delivery-date: Thu, 20 Aug 2026 06:24:00 -0600

Received: from doctor by doctor.nl2k.ab.ca with local (Exim 4.99.5 (FreeBSD))

(envelope-from )

id 1wx1nj-00000000Kci-2TGE

for dave@doctor.nl2k.ab.ca;

Thu, 20 Aug 2026 06:23:19 -0600

Resent-From: The Doctor

Resent-Date: Thu, 20 Aug 2026 06:23:19 -0600

Resent-Message-ID:

Resent-To: Dave Yadallee

Received: from naritagodo.jp ([60.43.199.30]:43376)

by doctor.nl2k.ab.ca with esmtps (TLS1.3) tls TLS_AES_256_GCM_SHA384

(Exim 4.99.5 (FreeBSD))

(envelope-from )

id 1wx1Rb-000000008is-1dhi

for doctor@nl2k.ab.ca;

Thu, 20 Aug 2026 06:00:35 -0600

Received: from EC2AMAZ-CIPD8O7 (ec2-15-152-20-128.ap-northeast-3.compute.amazonaws.com [15.152.20.128])

by naritagodo.jp (Postfix) with ESMTPA id CF15C5A59B

for ; Thu, 20 Aug 2026 20:59:37 +0900 (JST)

Authentication-Results: naritagodo.jp; arc=none smtp.remote-ip=15.152.20.128

ARC-Seal: i=1; a=rsa-sha256; d=bizmw.com; s=default; t=1787227177; cv=none;

b=zkLrq30THmrR567YXuf1gOI/NK8n/3Hab1d86t2eldAx0g3Iz+3edAxd5fqzneI03/JlCXXOrjnb9m7k1Jft6Hp4P7avXwxC7H43OfcOC2BWxGAKqM7hw02JXWO0XqB9J+9n0TBWtDkKnUFJ0x9L/IAGnmwzZjHRdQ4obe59K+k=

ARC-Message-Signature: i=1; a=rsa-sha256; d=bizmw.com; s=default;

t=1787227177; c=relaxed/relaxed;

bh=Lt/lNeEHknRieIRaJauyPfsXwp333G2AEIxFRMJlw8E=;

h=DKIM-Signature:MIME-Version:From:To:Date:Subject; b=PYGsbRcUfMg4Uzu8NNVW1a60cvLitDqPhK1aiR/xBrShSDWJdA8GeEDYsNorYv2WuCpaf4tQaLu+4zffMECDY6d5IdzZxkfCSLSz2qEufQQjP9mYTmKtIh8easDP1AxL4O6br6PzGFrEULzlIlwstHYE1OrBBtrtbftyk4A/mng=

ARC-Authentication-Results: i=1; naritagodo.jp

DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=naritagodo.jp;

s=bizmw; t=1787227177;

bh=Lt/lNeEHknRieIRaJauyPfsXwp333G2AEIxFRMJlw8E=;

h=From:To:Date:Subject:From;

b=foaa7bZQ5SVRrC8OMUp9P430C1qSHkJ3h9Xn9FBf/4csIF2Bd1rBuH3l5ZCuBo8qo

/yCyA2hp2eZX/xeoa+hUELj4s2NuusvGaY9/56VRFljvkdAL7QKKx6CPQ2En6CfJed

5e1nHJPzsznSesXNJ2Yi8B6ji1qk9kBGWCrCiQTY=

MIME-Version: 1.0

From: "Class Member Information"

To: doctor@nl2k.ab.ca

Date: 20 Aug 2026 11:59:37 +0000

Subject: =?utf-8?B?SW5mb3JtYXRpb24gZm9yIFNldHRsZW1lbnQgQ2xhc3MgTWVt?=

=?utf-8?B?YmVycyBSZWYgTm/CuiA6IDMzNzYyODExNzAgOC8yMC8yMDI2IDExOjU5?=

=?utf-8?B?OjM3IEFN?=

Content-Type: multipart/alternative;

boundary=--boundary_9295_2aedae34-c42c-4a79-8fd9-ef3f1d51ff47

X-Spam_score: 10.1

X-Spam_score_int: 101

X-Spam_bar: ++++++++++

X-Spam_report: Spam detection software, running on the system "doctor.nl2k.ab.ca",

has identified this incoming email as possible spam. The original

message has been attached to this so you can view it or label

similar future email. If you have any questions, see

@@CONTACT_ADDRESS@@ for details.



Content preview:
xmlns:v="urn:schemas-microsoft-com:vml" xmlns:o="urn:schemas-microsoft-com:office:office">




Content analysis details: (10.1 points, 5.0 required)



pts rule name description

---- ---------------------- --------------------------------------------------

0.1 MISSING_MID Missing Message-Id: header

1.0 RCVD_IN_WSFF RBL: Received via a relay in will-spam-for-food.eu.org

[15.152.20.128 listed in will-spam-for-food.eu.org]

[15.152.20.128 listed in will-spam-for-food.eu.org]

[15.152.20.128 listed in will-spam-for-food.eu.org]

[15.152.20.128 listed in will-spam-for-food.eu.org]

[15.152.20.128 listed in will-spam-for-food.eu.org]

[15.152.20.128 listed in will-spam-for-food.eu.org]

[15.152.20.128 listed in will-spam-for-food.eu.org]

[15.152.20.128 listed in will-spam-for-food.eu.org]

[60.43.199.30 listed in will-spam-for-food.eu.org]

[60.43.199.30 listed in will-spam-for-food.eu.org]

[60.43.199.30 listed in will-spam-for-food.eu.org]

[60.43.199.30 listed in will-spam-for-food.eu.org]

[60.43.199.30 listed in will-spam-for-food.eu.org]

[60.43.199.30 listed in will-spam-for-food.eu.org]

[60.43.199.30 listed in will-spam-for-food.eu.org]

[60.43.199.30 listed in will-spam-for-food.eu.org]

1.5 RCVD_IN_AHBL RBL: AHBL: sender is listed in dnsbl.ahbl.org

[60.43.199.30 listed in dnsbl.ahbl.org]

[60.43.199.30 listed in dnsbl.ahbl.org]

[60.43.199.30 listed in dnsbl.ahbl.org]

[60.43.199.30 listed in dnsbl.ahbl.org]

[15.152.20.128 listed in dnsbl.ahbl.org]

[15.152.20.128 listed in dnsbl.ahbl.org]

[15.152.20.128 listed in dnsbl.ahbl.org]

[15.152.20.128 listed in dnsbl.ahbl.org]

1.5 RCVD_IN_AHBL_SPAM RBL: AHBL: Spam Source in dnsbl.ahbl.org

[60.43.199.30 listed in dnsbl.ahbl.org]

0.5 RCVD_IN_AHBL_SMTP RBL: AHBL: Open SMTP relay in dnsbl.ahbl.org

[60.43.199.30 listed in dnsbl.ahbl.org]

0.5 RCVD_IN_AHBL_PROXY RBL: AHBL: Open Proxy server in dnsbl.ahbl.org

[60.43.199.30 listed in dnsbl.ahbl.org]

0.0 RCVD_IN_AHBL_RTB RBL: AHBL: Real-Time Blocked in dnsbl.ahbl.org

[60.43.199.30 listed in dnsbl.ahbl.org]

-2.0 RCVD_IN_RP_SAFE RBL: Sender in ReturnPath Safe - Contact

safe-sa@returnpath.net

[Excessive Number of Queries | ]

-3.0 RCVD_IN_RP_CERTIFIED RBL: Sender in ReturnPath Certified - Contact

cert-sa@returnpath.net

[Excessive Number of Queries | ]

1.1 URIBL_GREY Contains an URL listed in the URIBL greylist

[URI: squarespace.com]

-0.0 SPF_HELO_PASS SPF: HELO matches SPF record

-0.0 SPF_PASS SPF: sender matches SPF record

-0.0 T_RP_MATCHES_RCVD Envelope sender domain matches handover relay

domain

1.3 RCVD_IN_RP_RNBL RBL: Relay in RNBL,

https://senderscore.org/blacklistlookup/

[60.43.199.30 listed in bl.score.senderscore.com]

2.8 FONT_ZERO BODY: Nobody likes invisible fonts in emails

0.0 HTML_MESSAGE BODY: HTML included in message

0.0 HTML_FONT_SIZE_HUGE BODY: HTML font size is huge

0.0 MIME_BASE64_TEXT RAW: Message text disguised using base64 encoding

0.0 LOTS_OF_MONEY Huge... sums of money

0.0 T_DKIM_INVALID DKIM-Signature header exists but is not valid

4.0 DOS_BODY_HIGH_NO_MID High bit body and no message ID header

0.8 SARE_FROM_SPAM_WORD3 I don't know people named this!

0.0 T_MONEY_PERCENT X% of a lot of money for you

Subject: {SPAM?} =?utf-8?B?SW5mb3JtYXRpb24gZm9yIFNldHRsZW1lbnQgQ2xhc3MgTWVt?=

=?utf-8?B?YmVycyBSZWYgTm/CuiA6IDMzNzYyODExNzAgOC8yMC8yMDI2IDExOjU5?=

=?utf-8?B?OjM3IEFN?=







Public Notice



Loblaw/Weston Packaged Bread

Class Actions Settlement







LONDON, ONTARIO — ISSUED BY VERITA GLOBAL, LLC, CLAIMS ADMINISTRATOR



You are receiving this notice because you were identified as having claimed a $100–$200 Loblaw Card from the Packaged Bread Loblaw Card Program (2008–2026) and/or registered with the lawyers handling this class action.



Class actions have been certified/authorized by the Ontario Superior Court of Justice and the Superior Court of Quebec on behalf of all individuals and businesses resident in Canada who purchased Packaged Bread, alleging certain manufacturers and retailers engaged in anticompetitive conduct resulting in overcharges. The Courts have not yet made any decision on the merits of the claims or defences in either action.



The Plaintiffs have entered into a national settlement with Loblaw Companies Limited, Loblaws Inc., George Weston Limited, Weston Foods (Canada) Inc., Weston Bakeries Limited, and Weston Food Distribution Inc. (collectively “Loblaw/Weston”) for $500 million ($96 million already paid), plus their cooperation pursuing claims against non-settling defendants. In exchange, Settlement Class Members release Loblaw/Weston from claims relating to Packaged Bread.



If approved by both Courts, net settlement funds will be distributed to Settlement Class Members per the approved distribution protocol. Funds for personal-consumption purchasers will be distributed through a claims process; funds for resale purchasers will be held in trust pending a future Court determination.





Notice to Canadian Settlement Class Members





If you reside anywhere in Canada, except Quebec, and purchased Packaged Bread between January 1, 2008 and December 31, 2025, and wish to participate, you do not need to do anything to be included in the Ontario Settlement Class.

APPLY NOW



For more information and to exercise your rights, read the full Notice at

www.canadianbreadsettlement.ca



A further Notice will be published with details on how eligible Settlement Class Members may claim compensation once the Loblaw/Weston Agreement is approved.





Counsel of Record

Strosberg Wingfield Sasso LLP

www.swslitigation.com Orr Taylor LLP

www.orrtaylor.com



Verita Global, LLC · Claims Administrator



P.O. Box 3355 | London, Ontario | N6A 4K3 | Canada

DoNotReply@m.veritacanada.com



Unsubscribe from these notices

Bread scandal phish from Japan

X-Mozilla-Status: 0001

X-Mozilla-Status2: 00000000

Return-path:

Envelope-to: dave@doctor.nl2k.ab.ca

Delivery-date: Thu, 20 Aug 2026 06:24:00 -0600

Received: from doctor by doctor.nl2k.ab.ca with local (Exim 4.99.5 (FreeBSD))

(envelope-from )

id 1wx1nX-00000000K3W-0K9s

for dave@doctor.nl2k.ab.ca;

Thu, 20 Aug 2026 06:23:07 -0600

Resent-From: The Doctor

Resent-Date: Thu, 20 Aug 2026 06:23:06 -0600

Resent-Message-ID:

Resent-To: Dave Yadallee

Received: from naritagodo.jp ([60.43.199.30]:43376)

by doctor.nl2k.ab.ca with esmtps (TLS1.3) tls TLS_AES_256_GCM_SHA384

(Exim 4.99.5 (FreeBSD))

(envelope-from )

id 1wx1Rb-000000008is-1dhi

for doctor@nl2k.ab.ca;

Thu, 20 Aug 2026 06:00:35 -0600

Received: from EC2AMAZ-CIPD8O7 (ec2-15-152-20-128.ap-northeast-3.compute.amazonaws.com [15.152.20.128])

by naritagodo.jp (Postfix) with ESMTPA id CF15C5A59B

for ; Thu, 20 Aug 2026 20:59:37 +0900 (JST)

Authentication-Results: naritagodo.jp; arc=none smtp.remote-ip=15.152.20.128

ARC-Seal: i=1; a=rsa-sha256; d=bizmw.com; s=default; t=1787227177; cv=none;

b=zkLrq30THmrR567YXuf1gOI/NK8n/3Hab1d86t2eldAx0g3Iz+3edAxd5fqzneI03/JlCXXOrjnb9m7k1Jft6Hp4P7avXwxC7H43OfcOC2BWxGAKqM7hw02JXWO0XqB9J+9n0TBWtDkKnUFJ0x9L/IAGnmwzZjHRdQ4obe59K+k=

ARC-Message-Signature: i=1; a=rsa-sha256; d=bizmw.com; s=default;

t=1787227177; c=relaxed/relaxed;

bh=Lt/lNeEHknRieIRaJauyPfsXwp333G2AEIxFRMJlw8E=;

h=DKIM-Signature:MIME-Version:From:To:Date:Subject; b=PYGsbRcUfMg4Uzu8NNVW1a60cvLitDqPhK1aiR/xBrShSDWJdA8GeEDYsNorYv2WuCpaf4tQaLu+4zffMECDY6d5IdzZxkfCSLSz2qEufQQjP9mYTmKtIh8easDP1AxL4O6br6PzGFrEULzlIlwstHYE1OrBBtrtbftyk4A/mng=

ARC-Authentication-Results: i=1; naritagodo.jp

DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=naritagodo.jp;

s=bizmw; t=1787227177;

bh=Lt/lNeEHknRieIRaJauyPfsXwp333G2AEIxFRMJlw8E=;

h=From:To:Date:Subject:From;

b=foaa7bZQ5SVRrC8OMUp9P430C1qSHkJ3h9Xn9FBf/4csIF2Bd1rBuH3l5ZCuBo8qo

/yCyA2hp2eZX/xeoa+hUELj4s2NuusvGaY9/56VRFljvkdAL7QKKx6CPQ2En6CfJed

5e1nHJPzsznSesXNJ2Yi8B6ji1qk9kBGWCrCiQTY=

MIME-Version: 1.0

From: "Class Member Information"

To: doctor@nl2k.ab.ca

Date: 20 Aug 2026 11:59:37 +0000

Subject: =?utf-8?B?SW5mb3JtYXRpb24gZm9yIFNldHRsZW1lbnQgQ2xhc3MgTWVt?=

=?utf-8?B?YmVycyBSZWYgTm/CuiA6IDMzNzYyODExNzAgOC8yMC8yMDI2IDExOjU5?=

=?utf-8?B?OjM3IEFN?=

Content-Type: multipart/alternative;

boundary=--boundary_9295_2aedae34-c42c-4a79-8fd9-ef3f1d51ff47

X-Spam_score: 10.1

X-Spam_score_int: 101

X-Spam_bar: ++++++++++

X-Spam_report: Spam detection software, running on the system "doctor.nl2k.ab.ca",

has identified this incoming email as possible spam. The original

message has been attached to this so you can view it or label

similar future email. If you have any questions, see

@@CONTACT_ADDRESS@@ for details.



Content preview:
xmlns:v="urn:schemas-microsoft-com:vml" xmlns:o="urn:schemas-microsoft-com:office:office">




Content analysis details: (10.1 points, 5.0 required)



pts rule name description

---- ---------------------- --------------------------------------------------

0.1 MISSING_MID Missing Message-Id: header

1.0 RCVD_IN_WSFF RBL: Received via a relay in will-spam-for-food.eu.org

[15.152.20.128 listed in will-spam-for-food.eu.org]

[15.152.20.128 listed in will-spam-for-food.eu.org]

[15.152.20.128 listed in will-spam-for-food.eu.org]

[15.152.20.128 listed in will-spam-for-food.eu.org]

[15.152.20.128 listed in will-spam-for-food.eu.org]

[15.152.20.128 listed in will-spam-for-food.eu.org]

[15.152.20.128 listed in will-spam-for-food.eu.org]

[15.152.20.128 listed in will-spam-for-food.eu.org]

[60.43.199.30 listed in will-spam-for-food.eu.org]

[60.43.199.30 listed in will-spam-for-food.eu.org]

[60.43.199.30 listed in will-spam-for-food.eu.org]

[60.43.199.30 listed in will-spam-for-food.eu.org]

[60.43.199.30 listed in will-spam-for-food.eu.org]

[60.43.199.30 listed in will-spam-for-food.eu.org]

[60.43.199.30 listed in will-spam-for-food.eu.org]

[60.43.199.30 listed in will-spam-for-food.eu.org]

1.5 RCVD_IN_AHBL RBL: AHBL: sender is listed in dnsbl.ahbl.org

[60.43.199.30 listed in dnsbl.ahbl.org]

[60.43.199.30 listed in dnsbl.ahbl.org]

[60.43.199.30 listed in dnsbl.ahbl.org]

[60.43.199.30 listed in dnsbl.ahbl.org]

[15.152.20.128 listed in dnsbl.ahbl.org]

[15.152.20.128 listed in dnsbl.ahbl.org]

[15.152.20.128 listed in dnsbl.ahbl.org]

[15.152.20.128 listed in dnsbl.ahbl.org]

1.5 RCVD_IN_AHBL_SPAM RBL: AHBL: Spam Source in dnsbl.ahbl.org

[60.43.199.30 listed in dnsbl.ahbl.org]

0.5 RCVD_IN_AHBL_SMTP RBL: AHBL: Open SMTP relay in dnsbl.ahbl.org

[60.43.199.30 listed in dnsbl.ahbl.org]

0.5 RCVD_IN_AHBL_PROXY RBL: AHBL: Open Proxy server in dnsbl.ahbl.org

[60.43.199.30 listed in dnsbl.ahbl.org]

0.0 RCVD_IN_AHBL_RTB RBL: AHBL: Real-Time Blocked in dnsbl.ahbl.org

[60.43.199.30 listed in dnsbl.ahbl.org]

-2.0 RCVD_IN_RP_SAFE RBL: Sender in ReturnPath Safe - Contact

safe-sa@returnpath.net

[Excessive Number of Queries | ]

-3.0 RCVD_IN_RP_CERTIFIED RBL: Sender in ReturnPath Certified - Contact

cert-sa@returnpath.net

[Excessive Number of Queries | ]

1.1 URIBL_GREY Contains an URL listed in the URIBL greylist

[URI: squarespace.com]

-0.0 SPF_HELO_PASS SPF: HELO matches SPF record

-0.0 SPF_PASS SPF: sender matches SPF record

-0.0 T_RP_MATCHES_RCVD Envelope sender domain matches handover relay

domain

1.3 RCVD_IN_RP_RNBL RBL: Relay in RNBL,

https://senderscore.org/blacklistlookup/

[60.43.199.30 listed in bl.score.senderscore.com]

2.8 FONT_ZERO BODY: Nobody likes invisible fonts in emails

0.0 HTML_MESSAGE BODY: HTML included in message

0.0 HTML_FONT_SIZE_HUGE BODY: HTML font size is huge

0.0 MIME_BASE64_TEXT RAW: Message text disguised using base64 encoding

0.0 LOTS_OF_MONEY Huge... sums of money

0.0 T_DKIM_INVALID DKIM-Signature header exists but is not valid

4.0 DOS_BODY_HIGH_NO_MID High bit body and no message ID header

0.8 SARE_FROM_SPAM_WORD3 I don't know people named this!

0.0 T_MONEY_PERCENT X% of a lot of money for you

Subject: {SPAM?} =?utf-8?B?SW5mb3JtYXRpb24gZm9yIFNldHRsZW1lbnQgQ2xhc3MgTWVt?=

=?utf-8?B?YmVycyBSZWYgTm/CuiA6IDMzNzYyODExNzAgOC8yMC8yMDI2IDExOjU5?=

=?utf-8?B?OjM3IEFN?=









Public Notice



Loblaw/Weston Packaged Bread

Class Actions Settlement







LONDON, ONTARIO — ISSUED BY VERITA GLOBAL, LLC, CLAIMS ADMINISTRATOR



You are receiving this notice because you were identified as having claimed a $100–$200 Loblaw Card from the Packaged Bread Loblaw Card Program (2008–2026) and/or registered with the lawyers handling this class action.



Class actions have been certified/authorized by the Ontario Superior Court of Justice and the Superior Court of Quebec on behalf of all individuals and businesses resident in Canada who purchased Packaged Bread, alleging certain manufacturers and retailers engaged in anticompetitive conduct resulting in overcharges. The Courts have not yet made any decision on the merits of the claims or defences in either action.



The Plaintiffs have entered into a national settlement with Loblaw Companies Limited, Loblaws Inc., George Weston Limited, Weston Foods (Canada) Inc., Weston Bakeries Limited, and Weston Food Distribution Inc. (collectively “Loblaw/Weston”) for $500 million ($96 million already paid), plus their cooperation pursuing claims against non-settling defendants. In exchange, Settlement Class Members release Loblaw/Weston from claims relating to Packaged Bread.



If approved by both Courts, net settlement funds will be distributed to Settlement Class Members per the approved distribution protocol. Funds for personal-consumption purchasers will be distributed through a claims process; funds for resale purchasers will be held in trust pending a future Court determination.





Notice to Canadian Settlement Class Members





If you reside anywhere in Canada, except Quebec, and purchased Packaged Bread between January 1, 2008 and December 31, 2025, and wish to participate, you do not need to do anything to be included in the Ontario Settlement Class.

APPLY NOW



For more information and to exercise your rights, read the full Notice at

www.canadianbreadsettlement.ca



A further Notice will be published with details on how eligible Settlement Class Members may claim compensation once the Loblaw/Weston Agreement is approved.





Counsel of Record

Strosberg Wingfield Sasso LLP

www.swslitigation.com Orr Taylor LLP

www.orrtaylor.com



Verita Global, LLC · Claims Administrator



P.O. Box 3355 | London, Ontario | N6A 4K3 | Canada

DoNotReply@m.veritacanada.com



Unsubscribe from these notices







Bread scandal phish from Japan

X-Mozilla-Status: 0001

X-Mozilla-Status2: 00000000

Return-path:

Envelope-to: dave@doctor.nl2k.ab.ca

Delivery-date: Thu, 20 Aug 2026 06:23:00 -0600

Received: from doctor by doctor.nl2k.ab.ca with local (Exim 4.99.5 (FreeBSD))

(envelope-from )

id 1wx1nM-00000000Jb5-46BU

for dave@doctor.nl2k.ab.ca;

Thu, 20 Aug 2026 06:22:56 -0600

Resent-From: The Doctor

Resent-Date: Thu, 20 Aug 2026 06:22:56 -0600

Resent-Message-ID:

Resent-To: Dave Yadallee

Received: from sawada-house.co.jp ([60.43.239.242]:40354)

by doctor.nl2k.ab.ca with esmtps (TLS1.3) tls TLS_AES_256_GCM_SHA384

(Exim 4.99.5 (FreeBSD))

(envelope-from )

id 1wx19y-000000004oA-2Zjt

for doctor@netknow.ca;

Thu, 20 Aug 2026 05:42:22 -0600

Received: from EC2AMAZ-SMN07KM (ec2-15-152-97-137.ap-northeast-3.compute.amazonaws.com [15.152.97.137])

by sawada-house.co.jp (Postfix) with ESMTPA id 5FB0A611BF5F9

for ; Thu, 20 Aug 2026 20:41:23 +0900 (JST)

Authentication-Results: sawada-house.co.jp; arc=none smtp.remote-ip=15.152.97.137

ARC-Seal: i=1; a=rsa-sha256; d=bizmw.com; s=default; t=1787226083; cv=none;

b=GHOVdQIoEaUvbBg5Xn5FGR3LdgwVOYYpacccDs10yiJ00TEC+2FTWCjSTHDYTQ6PNXMj/cl6m4cN1vR+QcGtaP6Rs4VIweBcWoJb5K19HVfiGqk1AXV0gtRS7hhzguRv95Xtz+NozbM8/HIOuC4pdDfPXdMFBVl+7wntDxf9nmA=

ARC-Message-Signature: i=1; a=rsa-sha256; d=bizmw.com; s=default;

t=1787226083; c=relaxed/relaxed;

bh=W4CNAsZ/7VDefZWE76WGIw/Q/k1FTOEPVLTcAZY9pig=;

h=DKIM-Signature:MIME-Version:From:To:Date:Subject; b=C9o+1PKzROzF5kbZqpH8S1g6nnD2DpsC2SmXEOkMxZDHZiEfcztTwsFB24ctVOQQ4M1t4sH2JsSO6FwvQzhAH+9vzuWTGFM/CdUwTP+WPGu1Jd59Enb1iXNJvJktsi3BCn7wcV7iuJM9zLrXH6QirbJ1dFTynKMp+YTUIDQhBqc=

ARC-Authentication-Results: i=1; sawada-house.co.jp

DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=sawada-house.co.jp;

s=bizmw; t=1787226083;

bh=W4CNAsZ/7VDefZWE76WGIw/Q/k1FTOEPVLTcAZY9pig=;

h=From:To:Date:Subject:From;

b=WKKPUcZDUQu6rN4Pqx2+UPGDfT6jJi63DcwcCopK1DjP7604JNdyMghCyTNOLGLSB

NguEwUWYxjTWa8HG+byOmO0xV79c4CD/ES1ljQstBFtbpu0YjaenEAnccPk8IE2Kzd

jCyvxeRoHRfRSg17Ovgr9jk7UtBhb3Mv/0tR1XQw=

MIME-Version: 1.0

From: "Canadian Bread Purchasers"

To: doctor@netknow.ca

Date: 20 Aug 2026 11:41:23 +0000

Subject: =?utf-8?B?SW5mb3JtYXRpb24gQWJvdXQgSW5jbHVzaW9uIGluIHRoZSBT?=

=?utf-8?B?ZXR0bGVtZW50IENsYXNzIFJlZiBOb8K6IDogMDA2MTU1MDIxMyA4LzIw?=

=?utf-8?B?LzIwMjYgMTE6NDE6MjMgQU0=?=

Content-Type: multipart/alternative;

boundary=--boundary_8417_f75c8502-e10c-4d6c-ad69-a6c5bb4490ea

X-Spam_score: 9.3

X-Spam_score_int: 93

X-Spam_bar: +++++++++

X-Spam_report: Spam detection software, running on the system "doctor.nl2k.ab.ca",

has identified this incoming email as possible spam. The original

message has been attached to this so you can view it or label

similar future email. If you have any questions, see

@@CONTACT_ADDRESS@@ for details.



Content preview:
xmlns:v="urn:schemas-microsoft-com:vml" xmlns:o="urn:schemas-microsoft-com:office:office">




Content analysis details: (9.3 points, 5.0 required)



pts rule name description

---- ---------------------- --------------------------------------------------

0.1 MISSING_MID Missing Message-Id: header

1.0 RCVD_IN_WSFF RBL: Received via a relay in will-spam-for-food.eu.org

[15.152.97.137 listed in will-spam-for-food.eu.org]

[15.152.97.137 listed in will-spam-for-food.eu.org]

[15.152.97.137 listed in will-spam-for-food.eu.org]

[15.152.97.137 listed in will-spam-for-food.eu.org]

[15.152.97.137 listed in will-spam-for-food.eu.org]

[15.152.97.137 listed in will-spam-for-food.eu.org]

[15.152.97.137 listed in will-spam-for-food.eu.org]

[15.152.97.137 listed in will-spam-for-food.eu.org]

[60.43.239.242 listed in will-spam-for-food.eu.org]

[60.43.239.242 listed in will-spam-for-food.eu.org]

[60.43.239.242 listed in will-spam-for-food.eu.org]

[60.43.239.242 listed in will-spam-for-food.eu.org]

[60.43.239.242 listed in will-spam-for-food.eu.org]

[60.43.239.242 listed in will-spam-for-food.eu.org]

[60.43.239.242 listed in will-spam-for-food.eu.org]

[60.43.239.242 listed in will-spam-for-food.eu.org]

1.5 RCVD_IN_AHBL RBL: AHBL: sender is listed in dnsbl.ahbl.org

[60.43.239.242 listed in dnsbl.ahbl.org]

[60.43.239.242 listed in dnsbl.ahbl.org]

[60.43.239.242 listed in dnsbl.ahbl.org]

[60.43.239.242 listed in dnsbl.ahbl.org]

[15.152.97.137 listed in dnsbl.ahbl.org]

[15.152.97.137 listed in dnsbl.ahbl.org]

[15.152.97.137 listed in dnsbl.ahbl.org]

[15.152.97.137 listed in dnsbl.ahbl.org]

0.0 RCVD_IN_AHBL_RTB RBL: AHBL: Real-Time Blocked in dnsbl.ahbl.org

[60.43.239.242 listed in dnsbl.ahbl.org]

0.5 RCVD_IN_AHBL_PROXY RBL: AHBL: Open Proxy server in dnsbl.ahbl.org

[60.43.239.242 listed in dnsbl.ahbl.org]

0.5 RCVD_IN_AHBL_SMTP RBL: AHBL: Open SMTP relay in dnsbl.ahbl.org

[60.43.239.242 listed in dnsbl.ahbl.org]

1.5 RCVD_IN_AHBL_SPAM RBL: AHBL: Spam Source in dnsbl.ahbl.org

[60.43.239.242 listed in dnsbl.ahbl.org]

-2.0 RCVD_IN_RP_SAFE RBL: Sender in ReturnPath Safe - Contact

safe-sa@returnpath.net

[Excessive Number of Queries | ]

-3.0 RCVD_IN_RP_CERTIFIED RBL: Sender in ReturnPath Certified - Contact

cert-sa@returnpath.net

[Excessive Number of Queries | ]

1.1 URIBL_GREY Contains an URL listed in the URIBL greylist

[URI: squarespace.com]

-0.0 SPF_HELO_PASS SPF: HELO matches SPF record

-0.0 SPF_PASS SPF: sender matches SPF record

-0.0 T_RP_MATCHES_RCVD Envelope sender domain matches handover relay

domain

2.8 FONT_ZERO BODY: Nobody likes invisible fonts in emails

1.3 RCVD_IN_RP_RNBL RBL: Relay in RNBL,

https://senderscore.org/blacklistlookup/

[60.43.239.242 listed in bl.score.senderscore.com]

0.0 HTML_MESSAGE BODY: HTML included in message

0.0 HTML_FONT_SIZE_HUGE BODY: HTML font size is huge

0.0 MIME_BASE64_TEXT RAW: Message text disguised using base64 encoding

4.0 DOS_BODY_HIGH_NO_MID High bit body and no message ID header

0.0 T_DKIM_INVALID DKIM-Signature header exists but is not valid

0.0 LOTS_OF_MONEY Huge... sums of money

0.0 T_MONEY_PERCENT X% of a lot of money for you

Subject: {SPAM?} =?utf-8?B?SW5mb3JtYXRpb24gQWJvdXQgSW5jbHVzaW9uIGluIHRoZSBT?=

=?utf-8?B?ZXR0bGVtZW50IENsYXNzIFJlZiBOb8K6IDogMDA2MTU1MDIxMyA4LzIw?=

=?utf-8?B?LzIwMjYgMTE6NDE6MjMgQU0=?=









Public Notice



Loblaw/Weston Packaged Bread

Class Actions Settlement







LONDON, ONTARIO — ISSUED BY VERITA GLOBAL, LLC, CLAIMS ADMINISTRATOR



You are receiving this notice because you were identified as having claimed a $100–$200 Loblaw Card from the Packaged Bread Loblaw Card Program (2008–2026) and/or registered with the lawyers handling this class action.



Class actions have been certified/authorized by the Ontario Superior Court of Justice and the Superior Court of Quebec on behalf of all individuals and businesses resident in Canada who purchased Packaged Bread, alleging certain manufacturers and retailers engaged in anticompetitive conduct resulting in overcharges. The Courts have not yet made any decision on the merits of the claims or defences in either action.



The Plaintiffs have entered into a national settlement with Loblaw Companies Limited, Loblaws Inc., George Weston Limited, Weston Foods (Canada) Inc., Weston Bakeries Limited, and Weston Food Distribution Inc. (collectively “Loblaw/Weston”) for $500 million ($96 million already paid), plus their cooperation pursuing claims against non-settling defendants. In exchange, Settlement Class Members release Loblaw/Weston from claims relating to Packaged Bread.



If approved by both Courts, net settlement funds will be distributed to Settlement Class Members per the approved distribution protocol. Funds for personal-consumption purchasers will be distributed through a claims process; funds for resale purchasers will be held in trust pending a future Court determination.





Notice to Canadian Settlement Class Members





If you reside anywhere in Canada, except Quebec, and purchased Packaged Bread between January 1, 2008 and December 31, 2025, and wish to participate, you do not need to do anything to be included in the Ontario Settlement Class.

APPLY NOW



For more information and to exercise your rights, read the full Notice at

www.canadianbreadsettlement.ca



A further Notice will be published with details on how eligible Settlement Class Members may claim compensation once the Loblaw/Weston Agreement is approved.





Counsel of Record

Strosberg Wingfield Sasso LLP

www.swslitigation.com Orr Taylor LLP

www.orrtaylor.com



Verita Global, LLC · Claims Administrator



P.O. Box 3355 | London, Ontario | N6A 4K3 | Canada

DoNotReply@m.veritacanada.com



Unsubscribe from these notices





Chinese Products spam

X-Mozilla-Status: 0001

X-Mozilla-Status2: 00000000

Return-path:

Envelope-to: dave@doctor.nl2k.ab.ca

Delivery-date: Thu, 20 Aug 2026 06:23:00 -0600

Received: from doctor by doctor.nl2k.ab.ca with local (Exim 4.99.5 (FreeBSD))

(envelope-from )

id 1wx1nA-00000000J2m-2boA

for dave@doctor.nl2k.ab.ca;

Thu, 20 Aug 2026 06:22:44 -0600

Resent-From: The Doctor

Resent-Date: Thu, 20 Aug 2026 06:22:44 -0600

Resent-Message-ID:

Resent-To: Dave Yadallee

Received: from [103.217.187.187] (port=46978 helo=info.mk-miqifs.top)

by doctor.nl2k.ab.ca with esmtp (Exim 4.99.5 (FreeBSD))

(envelope-from )

id 1wx0RA-00000000NUD-1vWr

for sales@nk.ca;

Thu, 20 Aug 2026 04:56:06 -0600

Received: from ?? (125.89.212.112) by info.mk-miqifs.top id hgrejo0e97cj for ; Thu, 20 Aug 2026 18:54:32 +0800 (envelope-from )

From: "Luca"

Subject: This is Luca from Shenzhen Naweijia Technology, a specialized

manufacturer of full-range pet supplies.

To: sales@nk.ca

Content-Type: text/html; charset=UTF-8

MIME-Version: 1.0

Content-Transfer-Encoding: base64

Sender: info1@mk-miqifs.top

Reply-To: info@navajoy.com

Date: Thu, 20 Aug 2026 18:54:32 +0800

X-Priority: 3

X-MSMail-Priority: Normal

X-MimeOLE: Produced By Microsoft MimeOLE V6.00.3790.4913

Content-Disposition: inline

X-Spam_score: 15.5

X-Spam_score_int: 155

X-Spam_bar: +++++++++++++++

X-Spam_report: Spam detection software, running on the system "doctor.nl2k.ab.ca",

has identified this incoming email as possible spam. The original

message has been attached to this so you can view it or label

similar future email. If you have any questions, see

@@CONTACT_ADDRESS@@ for details.



Content preview: High-Quality & Cost-Effective Pet Supplies from China Dear

Buyer, Hope you are having a nice day! This is Luca from Shenzhen Naweijia

Technology Co., Ltd., a professional and reliable manufacturer fo [...]



Content analysis details: (15.5 points, 5.0 required)



pts rule name description

---- ---------------------- --------------------------------------------------

0.1 MISSING_MID Missing Message-Id: header

1.0 RCVD_IN_WSFF RBL: Received via a relay in will-spam-for-food.eu.org

[125.89.212.112 listed in will-spam-for-food.eu.org]

[125.89.212.112 listed in will-spam-for-food.eu.org]

[125.89.212.112 listed in will-spam-for-food.eu.org]

[125.89.212.112 listed in will-spam-for-food.eu.org]

[125.89.212.112 listed in will-spam-for-food.eu.org]

[125.89.212.112 listed in will-spam-for-food.eu.org]

[125.89.212.112 listed in will-spam-for-food.eu.org]

[125.89.212.112 listed in will-spam-for-food.eu.org]

[103.217.187.187 listed in will-spam-for-food.eu.org]

[103.217.187.187 listed in will-spam-for-food.eu.org]

[103.217.187.187 listed in will-spam-for-food.eu.org]

[103.217.187.187 listed in will-spam-for-food.eu.org]

[103.217.187.187 listed in will-spam-for-food.eu.org]

[103.217.187.187 listed in will-spam-for-food.eu.org]

[103.217.187.187 listed in will-spam-for-food.eu.org]

[103.217.187.187 listed in will-spam-for-food.eu.org]

1.5 RCVD_IN_AHBL RBL: AHBL: sender is listed in dnsbl.ahbl.org

[103.217.187.187 listed in dnsbl.ahbl.org]

[103.217.187.187 listed in dnsbl.ahbl.org]

[103.217.187.187 listed in dnsbl.ahbl.org]

[103.217.187.187 listed in dnsbl.ahbl.org]

[125.89.212.112 listed in dnsbl.ahbl.org]

[125.89.212.112 listed in dnsbl.ahbl.org]

[125.89.212.112 listed in dnsbl.ahbl.org]

[125.89.212.112 listed in dnsbl.ahbl.org]

0.5 RCVD_IN_AHBL_SMTP RBL: AHBL: Open SMTP relay in dnsbl.ahbl.org

[103.217.187.187 listed in dnsbl.ahbl.org]

0.5 RCVD_IN_AHBL_PROXY RBL: AHBL: Open Proxy server in dnsbl.ahbl.org

[103.217.187.187 listed in dnsbl.ahbl.org]

1.5 RCVD_IN_AHBL_SPAM RBL: AHBL: Spam Source in dnsbl.ahbl.org

[103.217.187.187 listed in dnsbl.ahbl.org]

0.0 RCVD_IN_AHBL_RTB RBL: AHBL: Real-Time Blocked in dnsbl.ahbl.org

[103.217.187.187 listed in dnsbl.ahbl.org]

1.5 RCVD_IN_CBL RBL: Received via a relay in cbl.abuseat.org

[Listed by XBL, see ]

1.5 RCVD_IN_SBL_XBL RBL: Received via a relay in Spamhaus SBL+XBL

[125.89.212.112 listed in sbl-xbl.spamhaus.org]

[125.89.212.112 listed in sbl-xbl.spamhaus.org]

3.6 RCVD_IN_SBL_CSS RBL: Received via a relay in Spamhaus SBL-CSS

[125.89.212.112 listed in zen.spamhaus.org]

-2.0 RCVD_IN_RP_SAFE RBL: Sender in ReturnPath Safe - Contact

safe-sa@returnpath.net

[Excessive Number of Queries | ]

-3.0 RCVD_IN_RP_CERTIFIED RBL: Sender in ReturnPath Certified - Contact

cert-sa@returnpath.net

[Excessive Number of Queries | ]

1.3 RCVD_IN_RP_RNBL RBL: Relay in RNBL,

https://senderscore.org/blacklistlookup/

[103.217.187.187 listed in bl.score.senderscore.com]

0.0 T_SPF_PERMERROR SPF: test of record failed (permerror)

0.2 MR_NOT_ATTRIBUTED_IP Beta rule: an non-attributed IPv4 found in

headers

0.2 MR_FROM_SHORT No description available.

0.0 HEADER_FROM_DIFFERENT_DOMAINS From and EnvelopeFrom 2nd level mail

domains are different

0.0 HTML_MESSAGE BODY: HTML included in message

1.1 MIME_HTML_ONLY BODY: Message only has text/html MIME parts

0.0 HTML_FONT_SIZE_HUGE BODY: HTML font size is huge

0.8 SARE_FROM_SPAM_WORD3 I don't know people named this!

0.5 FROM_SUSPICIOUS_NTLD From abused NTLD

1.3 RDNS_NONE Delivered to internal network by a host with no rDNS

2.5 TO_NO_BRKTS_MSFT To: misformatted and supposed Microsoft tool

1.0 XPRIO Has X-Priority header

Subject: {SPAM?} This is Luca from Shenzhen Naweijia Technology, a specialized

manufacturer of full-range pet supplies.



High-Quality & Cost-Effective Pet Supplies from China

Dear Buyer,

Hope you are having a nice day!

This is Luca from Shenzhen Naweijia Technology Co., Ltd., a professional and reliable manufacturer focused on all kinds of pet supplies in China. We have years of experience cooperating with overseas pet retailers, distributors and brand sellers, helping clients source high-quality products at factory-direct prices and expand their local pet business profitably.

We offer a full range of hot-selling & daily-use pet products, covering your mainstream market demands:

- Pet interactive toys, comfortable pet beds & durable pet houses

- Adjustable pet collars, harnesses and sturdy leashes

- Pet grooming tools and daily cleaning supplies

- Anti-slip pet feeding bowls and various daily pet accessories

- Custom OEM/ODM service (custom logo, design and packaging as your requirements)

We know what matters most to your business: stable quality, favorable price and punctual shipment.

All our products undergo strict quality inspection before delivery. We support low MOQ for trial orders and flexible wholesale terms, which is perfect for your market test and bulk procurement. Whether you need regular stock products or customized items, we can provide stable and long-term supply.

We are eager to build a long-term win-win partnership with your reputable company. Please feel free to contact me if you have any inquiries or need product catalogs & quotations.

Looking forward to your favorable reply!

Best regards,

Luca Qiu

Marketing Manager

Shenzhen Naweijia Technology Co., Ltd.

WhatsApp: +86 13560056180

Chinese products spam

X-Mozilla-Status: 0001

X-Mozilla-Status2: 00000000

Return-path:

Envelope-to: dave@doctor.nl2k.ab.ca

Delivery-date: Thu, 20 Aug 2026 06:23:00 -0600

Received: from doctor by doctor.nl2k.ab.ca with local (Exim 4.99.5 (FreeBSD))

(envelope-from )

id 1wx1mt-00000000IEv-0M4D

for dave@doctor.nl2k.ab.ca;

Thu, 20 Aug 2026 06:22:27 -0600

Resent-From: The Doctor

Resent-Date: Thu, 20 Aug 2026 06:22:26 -0600

Resent-Message-ID:

Resent-To: Dave Yadallee

Received: from out208-146.dm.aliyun.com ([140.205.208.146]:25832)

by doctor.nl2k.ab.ca with esmtps (TLS1.3) tls TLS_AES_256_GCM_SHA384

(Exim 4.99.5 (FreeBSD))

(envelope-from )

id 1wx098-00000000KPn-34Gp

for doctor@nk.ca;

Thu, 20 Aug 2026 04:37:26 -0600

X-AliDM-RcptTo: ZG9jdG9yQG5rLmNh

Feedback-ID: default:zoule@zpjrt.cn:alibabak_SmtpBatch:276535

DKIM-Signature:v=1; a=rsa-sha256; c=relaxed/relaxed;

d=zpjrt.cn; s=aliyun-cn-hangzhou;

t=1787222183; h=From:To:Subject:Message-ID:Date:MIME-Version:Content-Type;

bh=FCHTix6JLnPOSkmWDwCHjQMQ8MIbmiiowwkhkBWp0Tw=;

b=GLKHE65ws2LHCopXwoV8A2oSlS5McNWn0hGq2iYXL8mcFg53Eci09ODOL6m7D/HQHDGv2dXZ2iYBtn7a6tzXmRA7VA1kP7Ty1xtsS4Gk9gZLYMzdIYvAh6pwQcZ7j6g17yWBbxOLkGiXgx7RTIHyjn8ntHCu3S+6jKoehRTrGIU=

Received: from 127.0.0.1(mailfrom:zoule@zpjrt.cn fp:SMTPD_-VHcGCqyN60 cluster:AY35D)

by smtpdm.aliyun.com(127.0.0.1);

Thu, 20 Aug 2026 18:36:21 +0800

X-EnvId: 600000350136144410

Content-Transfer-Encoding: base64

From: jenny

Sender: jenny

To: doctor@nk.ca

Reply-To: jenny

Subject: Re: 100G over one fiber

Message-ID: <56768a0f-d527-1a49-1fee-d974f5f4cfce@zpjrt.cn>

Date: Thu, 20 Aug 2026 10:36:21 +0000

MIME-Version: 1.0

Content-Type: text/html; charset=utf-8

X-Spam_score: 13.7

X-Spam_score_int: 137

X-Spam_bar: +++++++++++++

X-Spam_report: Spam detection software, running on the system "doctor.nl2k.ab.ca",

has identified this incoming email as possible spam. The original

message has been attached to this so you can view it or label

similar future email. If you have any questions, see

@@CONTACT_ADDRESS@@ for details.



Content preview: Hi Just following up on the 100G BiDi 80km solution.



Content analysis details: (13.7 points, 5.0 required)



pts rule name description

---- ---------------------- --------------------------------------------------

1.5 RCVD_IN_AHBL RBL: AHBL: sender is listed in dnsbl.ahbl.org

[140.205.208.146 listed in dnsbl.ahbl.org]

[140.205.208.146 listed in dnsbl.ahbl.org]

[140.205.208.146 listed in dnsbl.ahbl.org]

[140.205.208.146 listed in dnsbl.ahbl.org]

0.5 RCVD_IN_AHBL_SMTP RBL: AHBL: Open SMTP relay in dnsbl.ahbl.org

[140.205.208.146 listed in dnsbl.ahbl.org]

0.5 RCVD_IN_AHBL_PROXY RBL: AHBL: Open Proxy server in dnsbl.ahbl.org

[140.205.208.146 listed in dnsbl.ahbl.org]

0.0 RCVD_IN_AHBL_RTB RBL: AHBL: Real-Time Blocked in dnsbl.ahbl.org

[140.205.208.146 listed in dnsbl.ahbl.org]

1.5 RCVD_IN_AHBL_SPAM RBL: AHBL: Spam Source in dnsbl.ahbl.org

[140.205.208.146 listed in dnsbl.ahbl.org]

2.5 URIBL_DBL_SPAM Contains a spam URL listed in the DBL blocklist

[URI: zpjrt.cn]

1.9 URIBL_JP_SURBL Contains an URL listed in the JP SURBL blocklist

[URI: zpjrt.cn]

1.9 URIBL_ABUSE_SURBL Contains an URL listed in the ABUSE SURBL blocklist

[URI: zpjrt.cn]

-3.0 RCVD_IN_RP_CERTIFIED RBL: Sender in ReturnPath Certified - Contact

cert-sa@returnpath.net

[Excessive Number of Queries | ]

-2.0 RCVD_IN_RP_SAFE RBL: Sender in ReturnPath Safe - Contact

safe-sa@returnpath.net

[Excessive Number of Queries | ]

1.0 RCVD_IN_WSFF RBL: Received via a relay in will-spam-for-food.eu.org

[140.205.208.146 listed in will-spam-for-food.eu.org]

[140.205.208.146 listed in will-spam-for-food.eu.org]

[140.205.208.146 listed in will-spam-for-food.eu.org]

[140.205.208.146 listed in will-spam-for-food.eu.org]

[140.205.208.146 listed in will-spam-for-food.eu.org]

[140.205.208.146 listed in will-spam-for-food.eu.org]

[140.205.208.146 listed in will-spam-for-food.eu.org]

[140.205.208.146 listed in will-spam-for-food.eu.org]

-0.0 RCVD_IN_DNSWL_NONE RBL: Sender listed at http://www.dnswl.org/, no

trust

[140.205.208.146 listed in list.dnswl.org]

-0.2 RCVD_IN_MSPIKE_H2 RBL: Average reputation (+2)

[140.205.208.146 listed in wl.mailspike.net]

1.3 RCVD_IN_RP_RNBL RBL: Relay in RNBL,

https://senderscore.org/blacklistlookup/

[140.205.208.146 listed in bl.score.senderscore.com]

-0.0 SPF_PASS SPF: sender matches SPF record

0.0 HTML_MESSAGE BODY: HTML included in message

1.1 MIME_HTML_ONLY BODY: Message only has text/html MIME parts

0.0 HTML_FONT_SIZE_HUGE BODY: HTML font size is huge

0.0 HTML_IMAGE_RATIO_06 BODY: HTML has a low ratio of text to image area

1.6 HTML_IMAGE_ONLY_12 BODY: HTML: images with 800-1200 bytes of words

0.0 T_DKIM_INVALID DKIM-Signature header exists but is not valid

1.0 VOWEL_URI_5 URI hostname with 5 consecutive vowels

2.0 RATWR8_MESSID Message-ID with excessive dashes and dollars

0.0 UNPARSEABLE_RELAY Informational: message has unparseable relay lines

0.5 VOWEL_FROM_5 Impronouncable from header (6 consecutive vowels)

0.0 T_REMOTE_IMAGE Message contains an external image

Subject: {SPAM?} Re: 100G over one fiber







Hi



Just following up on the 100G BiDi 80km solution.



If you share your switch brand and model, I can check compatibility and send the matching specifications.



Would that be useful?



Jenny

Axonode



If this is not relevant, reply “no” and I won't follow up.



tx1lwqanq2ecz